Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G20440-AT4G28550
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Ypt/Rab-GAP domain of gyp1p superfamily protein
Function (paralog2):Ypt/Rab-GAP domain of gyp1p superfamily protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-0.93746072993281
Log2 mRNA fold difference:-0.54581627279982
Log2 TE fold difference:-0.38236115043367
Sequences
Protein sequence

MFCCGFMWKSGGEDLQGFYPVRPECQPDVPRTRFKSRAGKTLSARRWHAAFTEDGHLDME
KVLRRIQRGGIHPSIKGAVWEFLLGCYDPDSTFEERNILRNRRREQYGAWKEECKKMVPV
IGSGKYVTMAVVQENGNPIDESSVENQGWIVKNTVTDERVLQWMLSLHQIGLDVARTDRY
LCFYENDRNQSKLWDVLAIYTWLNLDIGYVQGMNDICSPMIILFDDEGDAFWCFERAMRR
LRENFRATATSMGVQTQLGVLSQVIKTVDPRLHQHLEDLDGGEYLFAIRMLMVLFRREFS
FLDALYLWELMWAMEYNPTMFATYEELENRNNAASDPKLLKRYGKFERKYINSGQNEQHR
NTLAVFVVASVLQTKNKRLLKEAKGLDDVVQILGDIAGNLDAKKACKEALKIHEKFLKKA
NSNKQ

MICCGFMWKSGGEDLQGFYPVREECVADVPRTRFKSRAGKTLSARKWHAAFTGDGHLDME
RVLRRIQRGGIHPSIKGEVWEFLLGAYDPDSTFEERNKLRNHRREQYYAWKEECKNMVPL
VGSGKFVTMAVVAEDGQPLEESSVDNQEWVVKTAITDKRVLQWMLVLSQIGLDVVRTDRY
LCFYESESNQARLWDILSIYTWLNPDIGYVQGMNDICSPMIILLEDEADAFWCFERAMRR
LRENFRTTATSMGVQTQLGMLSQVIKTVDPRLHQHLEDLDGGEYLFAIRMLMVLFRREFS
FLDALYLWELMWAMEYNPNKFASYEEPQNMNNSSGQDPRLLKQYGKFERKYIKSGQNEQH
NTLAVFVVASVLETKNKRLLKEAKGLDDVVQILGGIAGNLDARKACKEALKIHEKFLKKA
NSKH

Other information
Ka divergence:-0.0147371KaKs divergence:0.170574
GC content 1 (%):43GC content 2 (%):42GC content divergence:-0.012
Length 1 (bp):1278Length 2 (bp):1275Length divergence:-0.001
MFE 1 (kcal):-384.77MFE 2 (kcal):-371.6MFE divergence-0.017