Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G20530-AT4G28510
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):prohibitin 6
Function (paralog2):prohibitin 1

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.57033086905527
Log2 mRNA fold difference:-0.64267040316865
Log2 TE fold difference:0.12899239790125
Sequences
Protein sequence

MNFKNVKVPKGPGGGVIAAVVIGGLSLYGATHTLYNVDGGHRAIVFNRLVGIKDKVYPEG
THLMIPWFERPIIYDVRAKPYLVESTSGSRDLQMVKIGLRVLTRPMADQLPEVYRSLGEN
YRERVLPSIIHETLKAVVAQYNASQLITQRESVSREIRKILTLRAANFHIALDDVSITGL
TFGKEFTAAIEGKQVAAQEAERAKFIVEKAEQDKRSAVIRAEGEAKSAQLIGQAIANNQA
FLTLRKIEAAREIAQTISRSANKVYLSSNDLLLNLQAMDLDVKPKK

MNNVKVPKIPGGGAISTLLKVGIIGGLGLYGATHSLYNVEGGHRAIMFNRLVGIKDKVYP
EGTHLMIPWFERPVIYDVRARPYLVESTSGSRDLQMVKIGLRVLTRPMADQLPEIYRSLG
ENYSERVLPSIINETLKAVVAQYNASQLITQREAVSREIRKILTERAANFNVALDDVSIT
NLTFGKEFTAAIEAKQVAAQEAERAKFIVEKAEQDKRSAVIRAQGEAKSAQLIGQAIANN
QAFITLRKIEAAREIAQTIANSANKVYLSSDDLLLNLQGMNLDVDAKN

www.000webhost.com

Other information
Ka divergence:-0.171873KaKs divergence:-0.220736
GC content 1 (%):48GC content 2 (%):47GC content divergence:-0.011
Length 1 (bp):861Length 2 (bp):867Length divergence:0.003
MFE 1 (kcal):-276.59MFE 2 (kcal):-275.6MFE divergence-0.002