Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G20550-AT2G20560
Species:Arabidopsis
Duplication type:TD
Function (paralog1):HSP40/DnaJ peptide-binding protein
Function (paralog2):DNAJ heat shock family protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:1.1912710960321
Log2 mRNA fold difference:0.21218893268228
Log2 TE fold difference:0.81738245455367
Sequences
Protein sequence

MSHPRNADDIFSEFFGVSRPSGPSGPRNADDIYSEFFGVSSPSGPRNKDDIFSEFFEVSN
PSGPRDKDDISAEYFGVPSPSGSGSSGGREGGGGGGGTMHHGGARKAAPVEKKLPCSLED
LYKGTTKKMKISREIAGVFGKTTQVQEILTVDVKPGWKTGTKITFSEKGNEQPGVIPADL
VFIIDEKPHPVFTREGNDLVVTQKISVLEAFTGYTVNLTTLDGRRLTIPVNTVIHPEYVE
VVPNEGMPLQKDQAKKGNLRIKFNIKFPTTLTSEQKTGLKKLLG

MGVDYYKVLQVDRSASDDDLKKAYRKLAMKWHPDKNPNNKKDAEAMFKQISEAYEVLSDP
QKKAVYDQYGEEGLKGNVPPPDAGGATYFSTGDGPTSFRFNPRNADDIFAEFFGFSSPFG
GGRGGTRFSSSMFGDNMFASFGEGGGGGGGSMHHGGARKAAPIENKLPCSLEDLYKGTTK
KMRISREIADVSGKTMQVEEILTIDVKPGWKKGTKITFPEKGNEQPGVIPADLVFIIDEK
PHPVFTREGNDLIVTQKISLVEALTGYTVNLTTLDGRRLTIPVTNVVHPEYEEVVPKEGM
PLQKDQTKRGNLRIKFNIKFPTRLTSEQKTGVKKLLG

Other information
Ka divergence:-0.856507KaKs divergence:-0.860838
GC content 1 (%):46GC content 2 (%):47GC content divergence:0.011
Length 1 (bp):855Length 2 (bp):1014Length divergence:0.085
MFE 1 (kcal):-277.8MFE 2 (kcal):-313MFE divergence0.06