Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G20550-AT4G28480
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):HSP40/DnaJ peptide-binding protein
Function (paralog2):DNAJ heat shock family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:2.1979970018321
Log2 mRNA fold difference:2.0566800200063
Log2 TE fold difference:0.1385716904291
Sequences
Protein sequence

MSHPRNADDIFSEFFGVSRPSGPSGPRNADDIYSEFFGVSSPSGPRNKDDIFSEFFEVSN
PSGPRDKDDISAEYFGVPSPSGSGSSGGREGGGGGGGTMHHGGARKAAPVEKKLPCSLED
LYKGTTKKMKISREIAGVFGKTTQVQEILTVDVKPGWKTGTKITFSEKGNEQPGVIPADL
VFIIDEKPHPVFTREGNDLVVTQKISVLEAFTGYTVNLTTLDGRRLTIPVNTVIHPEYVE
VVPNEGMPLQKDQAKKGNLRIKFNIKFPTTLTSEQKTGLKKLLG

MGVDYYKVLQVDRSANDDDLKKAYRKLAMKWHPDKNPNNKKDAEAKFKQISEAYDVLSDP
QKRAVYDQYGEEGLKGNVPPPNAATSGASYFSTGDGSSSFRFNPRSADDIFAEFFGFSTP
FGGGGGGTGGQRFASRMFGDDMYASFGEGAGGGGAMHHHHHHHHHAAARKVAPIENKLPC
SLEDLYKGTTKKMKISREIVDVSGKAMQVEEILTIGVKPGWKKGTKITFPEKGNEHPGVI
PADLVFIIDEKPHPVFTREGNDLIVTQKVSLADALTGYTANIATLDGRTLTIPITNVIHP
EYEEVVPKEGMPLQKDQTKKGNLRIKFNIKFPARLTAEQKAGFKKLIG

www.000webhost.com

Other information
Ka divergence:-0.698144KaKs divergence:-0.74439
GC content 1 (%):46GC content 2 (%):46GC content divergence:0
Length 1 (bp):855Length 2 (bp):1047Length divergence:0.101
MFE 1 (kcal):-277.8MFE 2 (kcal):-321.3MFE divergence0.073