Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G20580-AT4G28470
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):26S proteasome regulatory subunit S2 1A
Function (paralog2):26S proteasome regulatory subunit S2 1B

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-1.1222869234757
Log2 mRNA fold difference:-1.6145570449204
Log2 TE fold difference:0.45864233457931
Sequences
Protein sequence

MAPTQDPNSVGGGAKKDEATLKVPSKDPKKKDEKKDEDLSEEDLELKQNLELYVERVQDP
NPELQKAALESMRQEIRASTSSMTSVPKPLKFLRPHYGTLKAFHETMADSDLKKYLSDIL
SVLALTMSADGERESLRFRLIGTEGDIGSWGHEYVRNLAGEIAQEYTKRQSEEASIDDLM
ELVQQIVAFHMKHNAETEAVDLLMDVEDLDLLLEHVDKTNFKRTCNYLTSAARYLPGPDD
MLVLDISYMIYMKFEEYPNALQIALFLDNTQYVKQVFTSCTDLLKKKQFCYMIARHGITF
ELDDEMVADDDDREALQDIVNNTKLSEGYLTLARDIEVMEAKTPEDIYKAHLLDGRASSG
ASVDSARQNLAATFVNAFVNAGFGQDKLMTVPSDSTTGSSGNWLFKNKEHGKTSAAASLG
MIQLWDVDSGLSQLDKYFHSNDNPIIAGALLGVGIVNCGIKNDCDPALALLGDYIDKEDS
SVRIGAIMGLGISYAGSQNDQIRNKLSPILNDAKAPLDVIAFASLSLGMIYVGSCNEEVA
QSIIFALMDRSEAELGDALTRFLPLGLGLLYLGKQESVEATAEVSKTFNEKIRKYCDMTL
LSCAYAGTGNVLKVQDLLAQCGEHLEKGDIHQGPAVLGLAMVAMSEELGVDMEIRSLERM
LQYGEQNIRRAVPLALGLLCISNPKVTVMDTLSRLSHDTDSEVAMSAIISLGLIGAGTNN
ARIAGMLRNLSSYYYKDMSLLFCVRIAQGLVHMGKGLLTLSPFHSERFLLSPTALAGIVT
LLHACLDMKPIILGKYHYVLYFLVLAMQPRMMLTVDENLKPLSVPVRVGQAVDVVGQAGR
PKTITGFQTHSTPVLLAAGERAELATDKYIPLSPILEGFIILKENPDYREE

MAPVPDPNSVGGGAKRDEATTKIPSKDSKKKDDKKEEDLSEEDLQLKQNLELYVERVQDP
NPELQKIALESMRKEIRDSTSSMTSVPKPLKFLRPHYGVLKEFHAKMAESDLKKMLADIL
SVLALTMSAEGERESLNYRLNGSESDIGSWGHEYVRNLAGEIAKEYTIRQGEESSIEDLM
DLVQQIVSFHMKHNAETEAVDLLMDVEDLDLLLEHVDNTNFRRTCNYLTSAAKYLPGPDD
MLVLDIAYMIYIKFAEYPNALQIALFLDNMQYVKQVFTSCTDLVKKKQFCYMIARHGMTF
ELDQEMVANDEDKEALQDIVNNSKLSEGYLTLARDIEVMEAKTPEDIYKAHLLDGRASSG
PSVDSARQNLSATFVNAFVNAGFGQDKLMTVPSDSTSGSAGNWLFKNKEHGKTSAVASLG
MIQLWDVETGLGHLDKYFHSNDNPVVAGALLGVGIVNCGIKNDCDPAFALLSGYIDNEDS
SVRIGAIMGLGIAYAGSQNDQIKIRLSPILNDANAPLDVIAFAALSLGMIYVGSCNEEVA
QSIIFALMDRSEAELGEALTRFLPLGLGLLYLGKQESVEATAEVSKTFNEKIRKYCDMTL
LSCAYAGTGNVLKVQDLLAQCGEHLVKGDIHQGPAVIGLAMVAMSEELGLDMEIRSLERV
LQYGEQNIRRAVPLALGLLCISNPKVTVMDTLSRLSHDTDSEVAMAAIISLGLIGAGTNN
ARIAGMLRNLSSYYYKDASLLFCVRIAQGFVHMGKGLLTLNPFHSERLLLSPTALAGIVT
LLHACLDMKSIILGKYHYVLYFLVLAMQPRMMLTVDQSLKPISVPVRVGQAVDVVGQAGR
PKTITGFQTHSTPVLLAAGERAELATEKYIPLSPILEGFVILKENPDYREE

www.000webhost.com

Other information
Ka divergence:0.420542KaKs divergence:0.570838
GC content 1 (%):45GC content 2 (%):44GC content divergence:-0.011
Length 1 (bp):2676Length 2 (bp):2676Length divergence:0
MFE 1 (kcal):-852.03MFE 2 (kcal):-840.37MFE divergence-0.007