Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G20590-AT4G28430
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Reticulon family protein
Function (paralog2):Reticulon family protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:0.16458230477052
Log2 mRNA fold difference:-0.22757254618333
Log2 TE fold difference:0.17403124198571
Sequences
Protein sequence

MESTPPYHRSNTKSASRLQDSSNPPNLSLDLVLSSPNTPNPSSPVPLRDILLLPPSPLRK
SRTRLSDRLEMTSEDAMAVVRKRGKGKGGQKSLLASPRNPRRSRRRSEAVEEKEANLVIE
EIVKLPPRKRKTNGRPKKDKQSSAPPLCSSSDLPNTCQSDLNLIGEIISDLVMWRDVAKS
TLWFGFGCLSFLSSCFAKGVNFSVFSAVSNLGLVLLCGSFLSNTLCQRKNEDTKRAFHVS
EDDVLRSARRVLPATNFFISKTSELFSGEPSMTLKVTPFLLLGAEYGHLITLWRLSAFGF
FLSFTIPKLYSCYTHQISQKVERVKTRIGEAWGVCSHKKILAGSAVTAFWNLTSIRTRIF
AVFIILVIFRYRRQNLQLTPEEVEPVENEQEEETLPQEEETVPQEEETVPQEEEQTQPSE
ERALVVVVAET

MDSTTTPPSLRSNTRSALRLARNNKTLVKSHIPSLDLVLLSPKNNNGTPYPSPVSLSSPS
SPVTLREILLLSPSPLRKSRTRLSNRFDMEAAEAAVTARRSKTKGGQNGLLASPSPRNFR
RSRLRSEAMVDTKENTEPIVVVTDEKKQNQRKQKKLGRSKKEKHSSVPLLASPSPSSDQP
QDVCQGDLERIRENISDLIMWRDVAKSTLWFGFGCICFLSTCFAAKGFNFSVFSAISYLG
LLFLGVSFLSNTLRQRVTEEARRELKLSEDDVLRIARRMLPITNLAISKTSELFSGEPAM
TLKVAPFVLMGAEYGYLITLWRLCAFGFFLSFTIPKLYSCYASQLNQKVECAQRRFVEAW
GVCTHKKFVAGSAVTAFWNLTSLKTRFIAVFIIVVVIRYRRQNLQLDSEDEEEKKQQEKT
HPEQQKSPEDKSTSPRSAEEEQALVLVAETKAPKKLY

Other information
Ka divergence:0.0439494KaKs divergence:-0.197361
GC content 1 (%):44GC content 2 (%):43GC content divergence:-0.011
Length 1 (bp):1296Length 2 (bp):1374Length divergence:0.029
MFE 1 (kcal):-385.35MFE 2 (kcal):-403.86MFE divergence0.023