Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G20610-AT4G28420
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Tyrosine transaminase family protein
Function (paralog2):Tyrosine transaminase family protein

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:-5.0475694115044
Log2 mRNA fold difference:-5.7717778093165
Log2 TE fold difference:0.68836262513888
Sequences
Protein sequence

MSEEQPHANLAVPAFKTEKEPITQTRNGQSSVWRFGGSDKAAKASTVTLRGVIYMLFDNC
GKDVNKTILPLGHGDPSVYPCFRTCIEAEDAVVDVLRSGKGNSYGPGAGILPARRAVADY
MNRDLPHKLTPEDIFLTAGCNQGIEIVFESLARPNANILLPRPGFPHYDARAAYSGLEVR
KFDLLPEKEWEIDLEGIEAIADENTVAMVVINPNNPCGNVYSHDHLKKVAETARKLGIMV
ISDEVYDRTIFGDNPFVSMGKFASIVPVLTLAGISKGWVVPGWKIGWIALNDPEGVFETT
KVLQSIKQNLDVTPDPATIIQAALPAILEKADKNFFAKKNKILKHNVDLVCDRLKDIPCV
VCPKKPESCTYLLTKLELSLMDNIKDDIDFCVKLAREENLVFLPGDALGLKNWMRITIGV
EAHMLEDALERLKGFCTRHAKKTETETESLQALKLSDNNLEM

MNHNSNLVLPSHQTETQTQDETDISVWRFRGSDNAAKASSVTMRVIVYKLFDECSLDVKK
PLLPLAHGDPSVYPCYRTSILVENAVVDVLRSGKGNSYGPAAGILPARQAVADYVNRDLT
NKVKPNDVFITVGCNQGIEVVLQSLARPNANILLPRPSYPHYEARAVYSGLEVRKFDLLP
EKEWEIDLPGIEAMADENTVAMVIINPNNPCGNVYSYDHLKKVAETAKKLGIMVITDEVY
CQTIFGDKPFVPMGEFSSITPVITLGGISKGWIVPGWRIGWIALNDPRGILKSTGMVQSI
QQNLDITPDATTIVQAALPEILGKANKELFAKKNSMLKQNVELVCDRLKEIPCLVCNKKP
ESCTYLLTKLKLPLLEDIEDDMDFCMKLAKEENLVLLPGVALGLKNWIRITIGVEAQMLE
DALERLNGFCKRHLKKTESSFQALSNGKI

www.000webhost.com

Other information
Ka divergence:0.0286537KaKs divergence:0.79062
GC content 1 (%):47GC content 2 (%):47GC content divergence:0
Length 1 (bp):1389Length 2 (bp):1350Length divergence:-0.014
MFE 1 (kcal):-430.58MFE 2 (kcal):-423.09MFE divergence-0.009