Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G20650-AT4G28370
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):RING/U-box superfamily protein
Function (paralog2):RING/U-box superfamily protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:0.67284354160403
Log2 mRNA fold difference:0.60865305170513
Log2 TE fold difference:0.013602493252926
Sequences
Protein sequence

MNNLGNFGVWGFGFFSLSIWFAVLQQANGLRPIRETARSWGDEWLFGKKEKGGAGPFSAW
NITGTYRGTWKFLDTVNSSSKFPDFRKESGNSVIELVTSPTKITGVHYVQGAVVFHDVFD
NEHNVGGAQIKVEGVYIWPFRQLRLVANSGKKSDSGLEDDYLLSNPYHLLGIFSSQVFQE
SPRDRILKQKTSPIYEMEKHCNIEIAAQISQSTSSENNGDKDRYQIEGLMESPAVDDEVD
CFSPLSLNATSINVEVYYNKAVNYTLMVTFVSFLQVLLLIRQMEHSNTQSGAAKVSIVMI
GQQAIMDSYLCLLHLTAGILVESLFNAFATAAFFKFVVFSIFEMRYLLSIWKATRPSTSG
EGWETMRRELSFLYSRFYGILLGGILLMYEFHNYMRPILLLMYSFWIPQIVANVVRDSRK
PLHPYYILGMTVTRLAIPLYVFGCPKNFMRVEPSKAWCVSLCAFMGFQAGVLLLQHYFGS
RCFVPRKLLPEKYSYYRRLDHNVNRSRDCVICMTTIDLRHRINDCMVTPCEHIFHSGCLQ
RWMDIKMECPTCRRPLPPA

MKKREHLGLGFFEWQIILWLSIWLAISQQALGLRPIREKPRSWSDEWLFGRKQEAEVGPF
SAWNITGTYRGTWKFLNSLNSSSKFQDFQKENGNSVVELVAVPTKITGVHYVQGVVVFHD
VFDNEQNVGGAQINLEGVYIWPFRQLRLVANSGKESDSGQEDNNLLSNPYHLLGIFSSQV
FQESPRDRLLKRKLSPVNEMEKHCNIEIAAQVSRVASSENNGDKNYYHMEGLMESPGVGD
DGDCFSPLLLNATSVNVEVYYNKAVNYTLMVTFVSFLQVLLLIRQMEHGNTQSGAAKVSI
VMIGQQAIMDAYLCLLHLTAGILVESLFNAFATAAFFKFVVFSIFEMRYLLAIWKATRPS
NSGEGWETMRRELSFLYSRFYGILLGGILIMYQFHNYMQPILLLMYSFWIPQIVANVVRD
SRKPLHPYYILGMTATRLAIPLYVFGCPHNFMRVEPNKVWCICLCTFMGLQAVILLLQHY
FGSRCFVPRQMLPEKYNYHRRFNRDVSRTTDCVICMTAIDLRQHTSDCMVTPCEHFFHSG
CLQRWMDIKMECPTCRRSLPPA

www.000webhost.com

Other information
Ka divergence:-0.125662KaKs divergence:-0.241916
GC content 1 (%):43GC content 2 (%):42GC content divergence:-0.012
Length 1 (bp):1680Length 2 (bp):1689Length divergence:0.003
MFE 1 (kcal):-490.64MFE 2 (kcal):-511.8MFE divergence0.021