Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G20680-AT4G28320
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Glycosyl hydrolase superfamily protein
Function (paralog2):Glycosyl hydrolase superfamily protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-0.68738887452293
Log2 mRNA fold difference:-0.7428286139787
Log2 TE fold difference:0.056309475524746
Sequences
Protein sequence

MAAPTGNGPVIPILGFLTCVAFIYLSFGDLWFGLKTEGELAFVKRNGTQFVVDGKALYVN
GWNSYWFMDHAVNDHSRHRVSAMLEAGAKMGLTVCRTWAFNDGGYNALQISPGRFDERVF
KALDHVIAEAKTHGVRLLLSLVNNLQAYGGKTQYVNWAWQEGVGLSSSNDSFFFDPSIRR
YFKNYLTVLLTRKNSLTGIEYRNDPTIFAWELINEPRCMSDVSGDTLQDWINEMTAFIKS
IDNKHLLTVGLEGFYGPSSPKKLTVNPERWASELGSDFVRNSDSPNIDFASVHIYPDHWF
HDQGFEEKLKFVVKWMLSHIEDGDKELKKPVLFTEFGLSNLNKDYDPSQRDRFYRTIFDV
IYKSAKRKRSGAGTLVWQFLIEGMEGFNDDFGIVPWEQDSIQRLMIEQSCRLSRITGRHL
LDKKSIEMCSHRP

MVPTRNRPMLRILGFFICAAFIYLSFRDLWLNHKGKAKLGFVKRNGTQFVVDDKPLYVNG
WNSYWFMDHAVDEHSRNLVGEMLEAGAKMGLTVCRTWAFNDGGYNALQISPGRFDERVFQ
ALDHVIAEARKHDVRLLLSLVNNLQAYGGKTQYVKWAWQEGVGLSSSNDSFFFDPSIRNY
FKNYLKVLLTRKNSVTGIEYRNDPTIFAWELINEPRCTTDVSGKTLQDWIDEMTGFIKSI
DDKHLLTVGLEGFYGPNSPKGLTVNPEQWASQLGTDFVQNSNSSNIDFASVHIYPDHWFH
NQTFEEKLKFVVKWMQSHIEDGLKELKKPVLFTEFGLSNQNKDYEPSQRDKFYRIIFDVV
YKSAKRKKSGAGTLVWQLFMEGMETFNDDFGIVPHEQDSIYKLMIEQSCRLGKVTGRLKE
QKLKELCSHRH

www.000webhost.com

Other information
Ka divergence:0.37306KaKs divergence:0.545145
GC content 1 (%):44GC content 2 (%):42GC content divergence:-0.023
Length 1 (bp):1302Length 2 (bp):1296Length divergence:-0.002
MFE 1 (kcal):-401.63MFE 2 (kcal):-376.6MFE divergence-0.032