Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G20710-AT2G20720
Species:Arabidopsis
Duplication type:TD
Function (paralog1):Tetratricopeptide repeat (TPR)-like superfamily protein
Function (paralog2):Pentatricopeptide repeat (PPR) superfamily protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-0.58339374031229
Log2 mRNA fold difference:1.9032503052981
Log2 TE fold difference:-2.5847697899022
Sequences
Protein sequence

MKHLLLLRLVLPKPNYILRRSFLFHSGKTTPSPLDPYDTLQRRVARSGDPSASIIKVLDG
WLDQGNLVKTSELHSIIKMLRKFSRFSHALQISDWMSEHRVHEISEGDVAIRLDLIAKVG
GLGEAEKFFETIPMERRNYHLYGALLNCYASKKVLHKAEQVFQEMKELGFLKGCLPYNVM
LNLYVRTGKYTMVEKLLREMEDETVKPDIFTVNTRLHAYSVVSDVEGMEKFLMRCEADQG
LHLDWRTYADTANGYIKAGLTEKALEMLRKSEQMVNAQKRKHAYEVLMSFYGAAGKKEEV
YRLWSLYKELDGFYNTGYISVISALLKMDDIEEVEKIMEEWEAGHSLFDIRIPHLLITGY
CKKGMMEKAEEVVNILVQKWRVEDTSTWERLALGYKMAGKMEKAVEKWKRAIEVSKPGWR
PHQVVLMSCVDYLEGQRDMEGLRKILRLLSERGHISYDQLLYDMNGAGLSWKIVDAMGKG
RYVEEREVRI

MLCLYHQAEDHDMVVKLLGEMDEKKMQPQGLCFVKLLTSYSMASVVDVQGVEKFLSKWEV
MIQDKWTTFYFPGLVYIRAGFMEKGLALLRRSETFVDDGCREIIYGCLMTVYCNENLTED
VYRLWNLAKDYGISFDSSRCSDIVKAFTKKGDLDGVMEEWNECPNLDLMDFGLQHRCVKE
EAEKVVDMLGKKESKWESLAHKVNTLVEDEDAKEEERRKRVAEAMEGRLHDRWNPKNSMA
LSAFACVQYVEGRRDMESTADILRLLNKREQVSHAMDKNRLSLKMVEAMRGGGYVGGDD

www.000webhost.com

Other information
Ka divergence:0.695062KaKs divergence:0.534051
GC content 1 (%):47GC content 2 (%):46GC content divergence:-0.011
Length 1 (bp):1473Length 2 (bp):900Length divergence:-0.241
MFE 1 (kcal):-464.62MFE 2 (kcal):-283.62MFE divergence-0.242