Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G20750-AT4G28250
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):expansin B1
Function (paralog2):expansin B3

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:3.0208240488729
Log2 mRNA fold difference:4.4712796764523
Log2 TE fold difference:-1.9053140362885
Sequences
Protein sequence

MQLFPVILPTLCVFLHLLISGSGSTPPLTHSNQQVAATRWLPATATWYGSAEGDGSSGGA
CGYGSLVDVKPFKARVGAVSPILFKGGEGCGACYKVRCLDKTICSKRAVTIIATDQSPSG
PSAKAKHTHFDLSGAAFGHMAIPGHNGVIRNRGLLNILYRRTACKYRGKNIAFHVNAGST
DYWLSLLIEYEDGEGDIGSMHIRQAGSKEWISMKHIWGANWCIVEGPLKGPFSVKLTTLS
NNKTLSATDVIPSNWVPKATYTSRLNFSPVL

MQLFPVMLATLCIVLQLLIGSSALATTNRHVSNSHWLPAVATWYGSPNGDGSDGGACGYG
TLVDVKPLHARVGAVNPILFKNGEGCGACYKVRCLDKSICSRRAVTVIITDECPGCSKTS
THFDLSGAVFGRLAIAGESGPLRNRGLIPVIYRRTACKYRGKNIAFHVNEGSTDFWLSLL
VEFEDGEGDIGSMHIRQAGAREWLEMKHVWGANWCIIGGPLKGPFSIKLTTLSAGKTLSA
TDVVPRNWAPKATYSSRLNFSPVL

Other information
Ka divergence:-0.501384KaKs divergence:-0.733122
GC content 1 (%):52GC content 2 (%):51GC content divergence:-0.01
Length 1 (bp):816Length 2 (bp):795Length divergence:-0.013
MFE 1 (kcal):-272.2MFE 2 (kcal):-270.76MFE divergence-0.003