Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G20880-AT4G28140
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Integrase-type DNA-binding superfamily protein
Function (paralog2):Integrase-type DNA-binding superfamily protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.82358569663505
Log2 mRNA fold difference:1.0464651896173
Log2 TE fold difference:-0.55468338764012
Sequences
Protein sequence

MATAKNKGKSIRVLGTSEAEKKDEMELEEEFQFSSGKYKDSGPGSDMWLGDASSTSPRSL
RKTRTFDRHNPYLVSSYATPQPPTTTTCSVSFPFYLPPAIQNQQRFLHPNDPSGQRQQQM
ISFDPQQQVQPYVAQQQQQQQHLLQYWRDILKLSPSGRMMMMNMLRQESDLPLTRPPVQP
FSATKLYRGVRQRHWGKWVAEIRKPRNRTRLWLGTFDTAEEAAMAYDREAFKLRGETARL
NFPELFLNKQEPTPVHQKQCETGTTSEDSSRRGEDDSSTALAVGGVSEETGWAEAWFNAI
PEEWGPGSPLWDDYHFPISNHKDDLDATQNSSSDTI

MDFDEELNLCITKGKNVDHSFGGEASSTSPRSMKKMKSPSRPKPYFQSSSSPYSLEAFPF
SLDPTLQNQQQQLGSYVPVLEQRQDPTMQGQKQMISFSPQQQQQQQQYMAQYWSDTLNLS
PRGRMMMMMSQEAVQPYIATKLYRGVRQRQWGKWVAEIRKPRSRARLWLGTFDTAEEAAM
AYDRQAFKLRGHSATLNFPEHFVNKESELHDSNSSDQKEPETPQPSEVNLESKELPVIDV
GREEGMAEAWYNAITSGWGPESPLWDDLDSSHQFSSESSSSSPLSCPMRPFF

Other information
Ka divergence:0.0312151KaKs divergence:0.0696243
GC content 1 (%):48GC content 2 (%):46GC content divergence:-0.021
Length 1 (bp):1011Length 2 (bp):879Length divergence:-0.07
MFE 1 (kcal):-308.35MFE 2 (kcal):-246.64MFE divergence-0.111