Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G20990-AT2G21010
Species:Arabidopsis
Duplication type:TD
Function (paralog1):synaptotagmin A
Function (paralog2):Calcium-dependent lipid-binding (CaLB domain) family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-3.0822492548413
Log2 mRNA fold difference:-2.4073395869933
Log2 TE fold difference:-0.54738910858549
Sequences
Protein sequence

MGFFSTILGFCGFGVGISLGLVIGYVLFVYLLPNDVKDPEIRSIADQDPKAMLRMLPEIP
LWVKNPDFDRVDWINRFLEYMWPYLDKAICKTAKNIAKPIIEEQIPKYKIDSVEFETLTL
GSLPPTFQGMKVYLTDEKELIMEPCLKWAANPNILVAIKAFGLKATVQVVDLQVFAQPRI
TLKPLVPSFPCFANIYVSLMEKPHVDFGLKLGGADLMSIPGLYRFVQVDIFLLHTSFKSL
TCMSKNFFMRERADETVTFRLANTYEQIKDQVANMYLWPKTLVVPILDPAKAFRRPVGIV
HVKVVRAVGLRKKDLMGGADPFVKIKLSEDKIPSKKTTVKHKNLNPEWNEEFKFSVRDPQ
TQVLEFSVYDWEQVGNPEKMGMNVLALKEMVPDEHKAFTLELRKTLDGGEDGQPPDKYRG
KLEVELLYKPFTEEEMPKGFEETQAVQKAPEGTPAAGGMLVVIVHSAEDVEGKHHTNPYV
RIYFKGEERKTKHVKKNRDPRWNEEFTFMLEEPPVREKLHVEVLSTSSRIGLLHPKETLG
YVDIPVVDVVNNKRMNQKFHLIDSKNGKIQIELEWRTAS

MGMINPYVQIELSEDKISSKKTTVKHKNLNPEWNEEFKFSVRDPKTQVLEFNVYGWEKIG
KHDKMGMNVLALKELAPDERKAFTLELRKTLDGGEEGQPGKYRGKLEVELLYKPFTEEEM
QAVQKAPEGTPVAGGMLVVIVHSAEDVEGKHHTNPYVHIYFKGEERKTKNVKKNKDPKWN
EEFSFMLEEPPVHEKLHVEVFSTSSRIGLLHPKETLGYVDIPVVDVVNNKRMNQKFHLID
SKNGKIQIELDWQTAF

Other information
Ka divergence:0.650383KaKs divergence:0.572704
GC content 1 (%):44GC content 2 (%):43GC content divergence:-0.011
Length 1 (bp):1740Length 2 (bp):771Length divergence:-0.386
MFE 1 (kcal):-539.47MFE 2 (kcal):-220.4MFE divergence-0.42