Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G21060-AT4G38680
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):glycine-rich protein 2B
Function (paralog2):glycine rich protein 2

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:1.5421257693218
Log2 mRNA fold difference:1.7440841488163
Log2 TE fold difference:-0.23566664403362
Sequences
Protein sequence

MSGGGDVNMSGGDRRKGTVKWFDTQKGFGFITPSDGGDDLFVHQSSIRSEGFRSLAAEES
VEFDVEVDNSGRPKAIEVSGPDGAPVQGNSGGGGSSGGRGGFGGGGGRGGGRGGGSYGGG
YGGRGSGGRGGGGGDNSCFKCGEPGHMARECSQGGGGYSGGGGGGRYGSGGGGGGGGGGL
SCYSCGESGHFARDCTSGGAR

MSGDNGGGERRKGSVKWFDTQKGFGFITPDDGGDDLFVHQSSIRSEGFRSLAAEEAVEFE
VEIDNNNRPKAIDVSGPDGAPVQGNSGGGSSGGRGGFGGGRGGGRGSGGGYGGGGGGYGG
RGGGGRGGSDCYKCGEPGHMARDCSEGGGGYGGGGGGYGGGGGYGGGGGGYGGGGRGGGG
GGGSCYSCGESGHFARDCTSGGR

Other information
Ka divergence:0.0120545KaKs divergence:0.853462
GC content 1 (%):57GC content 2 (%):61GC content divergence:0.034
Length 1 (bp):606Length 2 (bp):612Length divergence:0.005
MFE 1 (kcal):-210.84MFE 2 (kcal):-241.8MFE divergence0.068