Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G21120-AT4G38730
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein of unknown function (DUF803)
Function (paralog2):Protein of unknown function (DUF803)

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-2.6274295270512
Log2 mRNA fold difference:-2.9755067137899
Log2 TE fold difference:0.18325475141553
Sequences
Protein sequence

METDNGKGLILAVASSVFIGSSFILKKKGLKRAGAIGTRAGYGGYTYLLEPLWWAGMVTM
IVGEAANFVAYIYAPAVLVTPLGALSIIISAVLAHFLLKEKLKKMGVLGCVSCIVGSVVI
VIHAPKEQTPNSVEEIWNLATQPAFLIYVAITMSIVLALILHFEPLCGQTNILVYIGICS
LMGALTVMSIKAIGIAIKLTMEGVSQIGYPQTWLFVMVAVTCVVTQLIYLNKALDTFNAA
IVSPVYYVMFTTLTIVASAIMFKDWSGQDAASVASELCGFITVLTGTMILHGTREEEQQQ
ASSEHVRWYDSRKSMNEEHLVSLYSPEY

MVSDNEMGLVLAVSSSVFIGSSFILKKKGLKRAAANGTRAGFGGYTYLLEPLWWVGLVTM
TFGEIANFVAYVYAPAVLVTPLGALSIIISAVLAHFLLDEKLRKMGVWGCVCCIVGSVMI
VIHAPQEQTPNSVEEIWKLAMQPAFLIYVAISMSIVLALILYCEPLCGQTNILVYIGICS
LMGSLTVMSIKAVGIAIKLTFEGINQIWYPETWFFAMVAAICVVMQMIYLNKALDTFNAA
IVSPIYYVMFTTLTIVASAIMFKDWNGQNTDSIASEICGFITVLTGTVILHSTREEEQAS
PRRMRWQDSGKSFDEEHLTSLYSPEY

Other information
Ka divergence:0.303744KaKs divergence:0.57471
GC content 1 (%):42GC content 2 (%):43GC content divergence:0.012
Length 1 (bp):987Length 2 (bp):981Length divergence:-0.003
MFE 1 (kcal):-289.6MFE 2 (kcal):-279.03MFE divergence-0.019