Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G21130-AT4G38740
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein
Function (paralog2):rotamase CYP 1

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:5.1870016911584
Log2 mRNA fold difference:5.2000956862067
Log2 TE fold difference:-0.14718634305046
Sequences
Protein sequence

MASHPKVFFDMTIGGAPAGKIVMELYTDKTPKTAENFRALCTGEKGVGRSGKPLHFKGSS
FHRVIPNFMCQGGDFTKGNGTGGESIYGAKFEDENFERKHTGPGILSMANAGANTNGSQF
FICTVKTDWLDGKHVVFGQVVEGLDVVKAIEKIGSSSGKPTKPVVIADCGEISS

MAFPKVYFDMTIDGQPAGRIVMELYTDKTPRTAENFRALCTGEKGVGGTGKPLHFKGSKF
HRVIPNFMCQGGDFTAGNGTGGESIYGSKFEDENFERKHTGPGILSMANAGANTNGSQFF
ICTVKTDWLDGKHVVFGQVVEGLDVVKAIEKVGSSSGKPTKPVVVADCGQLS

www.000webhost.com

Other information
Ka divergence:0.0777673KaKs divergence:0.595174
GC content 1 (%):49GC content 2 (%):55GC content divergence:0.058
Length 1 (bp):525Length 2 (bp):519Length divergence:-0.006
MFE 1 (kcal):-165.4MFE 2 (kcal):-184.7MFE divergence0.055