Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G21140-AT4G38770
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):proline-rich protein 2
Function (paralog2):proline-rich protein 4

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:4.2627109877725
Log2 mRNA fold difference:3.9700100913541
Log2 TE fold difference:0.24670327810287
Sequences
Protein sequence

MRILPKSGGGALCLLFVFALCSVAHSLSCDVKVVGDVEVIGYSEISKIKIPNAFSGLRVT
IECKAADSKGHFVTRGSGEVDETGKFHLNIPHDIVGDDGTLKEACYAHLQSAFGNPCPAH
DGLEASKIVFLSKSGQNHVLGLKKSLKFSPEVCISKFFWHMPKFPLPPPLNLPPLTFPKI
KKPCPPIYKPPVVIPKKPCPPKIAHKPIYKPPVPIYKPPVPIYKPPVVIPKKPCPPKIHK
PIYKPPVPIYKPPVVIPKKTFPPLHKPIYKHPVPIYKPIFKPPVVVIPKKPCPPLPKFPH
FPPKYIPHPKFGKWPPFPSHP

MRILPEPRGSVPCLLLLVSVLLSATLSLARVVEVVGYAESKIKTPHAFSGLRVTIDCKVN
KGHFVTKGSGNIDDKGKFGLNIPHDIVSDNGALKEECYAQLHSAAGTPCPAHDGLESTKI
VFLSKSGDKHILGLKQNLKFSPEICVSKFFWPMPKLPPFKGFDHPFPLPPPLELPPFLKK
PCPPKYSPPVEVPPPVPVYEPPPKKEIPPPVPVYDPPPKKEVPPPVPVYKPPPKVELPPP
IPKKPCPPKPPKIEHPPPVPVYKPPPKIEKPPPVPVYKPPPKIEHPPPVPVHKLPKKPCP
PKKVDPPPVPVHKPPTKKPCPPKKVDPPPVPVHKPPPKIVIPPPKIEHPPPVPVYKPPPK
IEHPPIYIPPIVKKPCPPPVPIYKPPVVIPKKPCPPPVPVYKPPVVVIPKKPCPPLPQLP
PLPKFPPLPPKYIHHPKFGKWPPLPPHP

Other information
Ka divergence:-0.105807KaKs divergence:-0.625796
GC content 1 (%):47GC content 2 (%):52GC content divergence:0.051
Length 1 (bp):966Length 2 (bp):1347Length divergence:0.165
MFE 1 (kcal):-239.6MFE 2 (kcal):-355.33MFE divergence0.195