Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G21190-AT4G38790
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):ER lumen protein retaining receptor family protein
Function (paralog2):ER lumen protein retaining receptor family protein

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:0.16708815790444
Log2 mRNA fold difference:0.0026385889766364
Log2 TE fold difference:0.16647990969749
Sequences
Protein sequence

MKTPIHAVSTWVRRQPPKVKAFLAVVSGMAALVLLKLIVHDHDNLFVAAEAVHSIGISVL
IYKLMKEKTCAGLSLKSQELTAIFLAVRLYCSFVMEYDIHTILDLATLGTTLWVIYMIRF
NLKTTYMEEKDNFALYYVLAPCVVLAVWIHPSTSHNILNRISWGFCVYLEAVSVLPQLRV
MQNTKIVEPFTAHYVFALGVARFFSCAHWVLQMMDTHGRLLVVLGYGLWPSMVIISEIVQ
TFILADFCYYYVKSVFGGQLVLRLPSGVV

MKATTKTPIHVVWSWVRRQPPKVKAFLAVVTGMAALVLLRFIVHDHDNLFVAAEAVHSIG
ICVLIYKLMKEKTCAGLSLKSQELTAIFLAVRLYCSIVMEYDIHTILDLATLGTTLWVIF
MIRFKLRASYMEDKDNFPLYYVLAPCVALAVFIHPSTSHNIINRISWALCVYLEAVSVLP
QLRVMQNTKIVEPFTAHYVFALGVARFLSCAHWVLQVVDTRGRLLVALGYGLWPSMVLIS
EIVQTFILADFCYYYVKSVFGGQLVLRLPSGVV

www.000webhost.com

Other information
Ka divergence:0.0311573KaKs divergence:0.870437
GC content 1 (%):43GC content 2 (%):45GC content divergence:0.023
Length 1 (bp):810Length 2 (bp):822Length divergence:0.007
MFE 1 (kcal):-231.04MFE 2 (kcal):-240.74MFE divergence0.021