Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G21230-AT4G38900
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Basic-leucine zipper (bZIP) transcription factor family protein
Function (paralog2):Basic-leucine zipper (bZIP) transcription factor family protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:0.10749817281598
Log2 mRNA fold difference:-0.075159765692283
Log2 TE fold difference:0.17089258102541
Sequences
Protein sequence

MGGGGDTTDTNMMQRVNSSSGTSSSSIPKHNLHLNPALIRSHHHFRHPFTGAPPPPIPPI
SPYSQIPATLQPRHSRSMSQPSSFFSFDSLPPLNPSAPSVSVSVEEKTGAGFSPSLPPSP
FTMCHSSSSRNAGDGENLPPRKSHRRSNSDVTFGFSSMMSQNQKSPPLSSLERSISGEDT
SDWSNLVKKEPREGFYKGRKPEVEAAMDDVFTAYMNLDNIDVLNSFGGEDGKNGNENVEE
MESSRGSGTKKTNGGSSSDSEGDSSASGNVKVALSSSSSGVKRRAGGDIAPTGRHYRSVS
MDSCFMGKLNFGDESSLKLPPSSSAKVSPTNSGEGNSSAYSVEFGNSEFTAAEMKKIAAD
EKLAEIVMADPKRVKRILANRVSAARSKERKTRYMAELEHKVQTLQTEATTLSAQLTHLQ
RDSMGLTNQNSELKFRLQAMEQQAQLRDGMHIIKTLSEKLNEEVQRLKLVIGEPNRRQSG
SSSSESKMSLNPEMFQQLSISQLQHQQMQHSNQCSTMKAKHTSND

MGDTEKCNSDMIQRLHSSFGTTSSSIPKNPISQLDLNPNFIRSSAPQFSKPFSDSGKRIG
VPPSHPNLIPPTSPFSQIPTTRQPGSHNFNPGGANHSRSMSQPNSFFSFDSLPPLSPSPF
RDHDVSMEDRDSGVFNSNHSLPPSPFTRCNSTSSSSLRVGESLPPRKSHRRSNSDIPSGF
NSMPLIPPRPLERSFSGGECADWSKSNPFVKKESSCEREGVGEREAMDDLFSAYMNLENI
DVLNSSEADDSKNGNENRDDMESSRASGTKTNGSDTEGESSSVNESANNNMNSSGEKRES
VKRRAAGGDIAPTTRHYRSVSVDSCFMEKLSFGDESLKPPPSPGSMSRKVSPTNSVDGNS
GAAFSIEFNNGEFTAAEMKKIMANDKLAEMAMSDPKRVKRNDPLFRILANRQSAARSKER
KMRYIVELEHKVQTLQTEATTLSAQLTLLQRDMMGLTNQNNELKFRLQAMEQQARLRDAL
NEALNGEVQRLKLAIGESSQNESERSKMQSLNAEMFQQLNISQLRQQPQQMQQQSHQQNH
QNGTMATKSESNE

www.000webhost.com

Other information
Ka divergence:-0.450747KaKs divergence:-0.270582
GC content 1 (%):45GC content 2 (%):46GC content divergence:0.011
Length 1 (bp):1578Length 2 (bp):1662Length divergence:0.026
MFE 1 (kcal):-491.24MFE 2 (kcal):-491.56MFE divergence0