Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G21240-AT4G38910
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):basic pentacysteine 4
Function (paralog2):basic pentacysteine 5

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-2.9883161250286
Log2 mRNA fold difference:-3.0986047476992
Log2 TE fold difference:0.0066061409889609
Sequences
Protein sequence

MENGGQYDNARFKPDYFKGAQSMWNMIPQHQIKEQHNALVMNKKIMSILAERDAAVHERN
QAVSAKKEAVAARDEALQQRDKALSERDKALIERDNAYAALQHHENSLNFALSGGKCVDG
DDCFGIGEPHKLEVFPLSTIPPEVTNTKVVNKRKKENKQGLSKVKKVGEDLNRRVPAPGK
KSRTDWDSQDVGLNLVTFDETTMPVPMCSCTGSTRQCYKWGNGGWQSSCCTTTLSQYPLP
QMPNKRHSRMGGRKMSGNVFSRLLSRLSAEGYDLSCPVDLKDYWARHGTNRYITIK

MESGGQYENGRYKPDYYKGTQSVNVMPKKEQHNALVMNKKIISILAERDAAVKERNEAVA
ATKEALASRDEALEQRDKALSERDNAIMETESALNALRYRENNLNYILSCAKRGGSQRFI
TEESHLPNPSPISTIPPEAANTRPTKRKKESKQGKKMGEDLNRPVASPGKKSRKDWDSND
VLVTFDEMTMPVPMCTCTGTARQCYKWGNGGWQSSCCTTTLSEYPLPQMPNKRHSRVGGR
KMSGSVFSRLLSRLAGEGHELSSPVDLKNYWARHGTNRYITIK

Other information
Ka divergence:-0.0124907KaKs divergence:-0.124562
GC content 1 (%):45GC content 2 (%):48GC content divergence:0.032
Length 1 (bp):891Length 2 (bp):852Length divergence:-0.022
MFE 1 (kcal):-275.21MFE 2 (kcal):-266.9MFE divergence-0.015