Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G21250-AT2G21260
Species:Arabidopsis
Duplication type:TD
Function (paralog1):NAD(P)-linked oxidoreductase superfamily protein
Function (paralog2):NAD(P)-linked oxidoreductase superfamily protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-2.4449434731707
Log2 mRNA fold difference:-2.487943809312
Log2 TE fold difference:0.11801040438907
Sequences
Protein sequence

MEITLNSGFKMPIVGLGVWRMEKEGIRDLILNAIKIGYRHLDCAADYRNETEVGDALTEA
FKTGLVKREDLFITTKLWNSDHGHVIEACKDSLKKLQLDYLDLFLVHFPVATKHTGVGTT
DSALGDDGVLDIDTTISLETTWHDMEKLVSMGLVRSIGISNYDVFLTRDCLAYSKIKPAV
NQIETHPYFQRDSLVKFCQKHGICVTAHTPLGGATANAEWFGTVSCLDDPVLKDVAEKYK
KTVAQVVLRWGIQRKTVVIPKTSKPARLEENFQVFDFELSKEDMEVIKSMERKYRTNQPA
KFWNIDLYA

MEITLNSGFKMPIIGLGVWRMEKEELRDLIIDAIKIGYRHLDCAANYKNEAEVGEALTEA
FTTGLVKREDLFITTKLWSSDHGHVIEACKDSLKKLQLDYLDLFLVHIPIATKHTGIGTT
DSALGDDGVLDIDTTISLETTWHDMEKLVSMGLVRSIGISNYDVFLTRDCLAYSKIKPAV
NQIETHPYFQRDSLVKFCQKHGICVTAHTPLGGATANAEWFGTVSCLDDPVLKDVAEKYK
QTVAQIVLRWGIQRNTVVIPKTSKPERLEENFQVFDFQLSKEDMEVIKSMERNYRTHQTA
KFWGIELYA

Other information
Ka divergence:0.261277KaKs divergence:-0.965144
GC content 1 (%):46GC content 2 (%):45GC content divergence:-0.011
Length 1 (bp):930Length 2 (bp):930Length divergence:0
MFE 1 (kcal):-296.4MFE 2 (kcal):-295.7MFE divergence-0.001