Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G21270-AT4G38930
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):ubiquitin fusion degradation 1
Function (paralog2):Ubiquitin fusion degradation UFD1 family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-1.1286129288974
Log2 mRNA fold difference:-1.1345835672789
Log2 TE fold difference:0.14356031735331
Sequences
Protein sequence

MVLRFCCHLLTYSVSLLPPITMFFDGYHYHGTTFEQSYRCYPASFIDKPQLESGDKIIMP
PSALDRLASLHIDYPMLFELRNAGIERVTHCGVLEFIAEEGMIYMPYWMMQNLLLQEGDI
VRVRNVTLPKGTYVKLQPHTTDFLDISNPKAILETALRNYSCLTSGDSIMVPYNNKKYFI
DIVETKPANAISIIETDCEVDFAPPLDYKEPERPTAPSAAKGPAKAEEVVDEPEPKFNPF
TGSGRRLDGRPLAYEPAPASSSKGKQPVVANGNGQSSVASSSEKATRAQGKLVFGANGNR
APKEAAPKVGAAKETKKEEQEKKDEPKFQAFSGKKYSLRG

MFYDGYAYHGTTFEQTYRCYPSSFIDKPQIESGDKIIMPPSALDRLASLQIDYPMLFELR
NASTDSFSHCGVLEFIAEEGVIYIPYWMMQNLLLQEGDMVRVRNVTLPKGTYVKLQPHTT
DFLDIANPKAILETALRNYSCLTVGDSIMVPYNNKKYFIDIVEAKPSNGISIIETDCEVD
FAPPLDYKEPERPVAPAPAKGEAKAKEVDVAEAEPKFNPFTGSGRRLDGRPLSYEPQPGA
ANSNGQSHPVASSSSSGSEKATQQNRGKLVFGSNVERSTKETTKVGAGKDRKQEEEAEKE
AKFQAFSGKKYSLRG

www.000webhost.com

Other information
Ka divergence:0.201377KaKs divergence:-0.118216
GC content 1 (%):44GC content 2 (%):44GC content divergence:0
Length 1 (bp):1023Length 2 (bp):948Length divergence:-0.038
MFE 1 (kcal):-305.5MFE 2 (kcal):-266.53MFE divergence-0.068