Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G21300-AT4G38950
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):ATP binding microtubule motor family protein
Function (paralog2):ATP binding microtubule motor family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-1.1631132030819
Log2 mRNA fold difference:-0.64926899401254
Log2 TE fold difference:-0.55022461383089
Sequences
Protein sequence

MGAIAGEELKKMEKTQVHVAREEKILVLVRLRPLNEKEILANEAADWECINDTTVLYRNT
LREGSTFPSAYSFDRVYRGECPTRQVYEDGPKEVALSVVKGINSSIFAYGQTSSGKTYTM
SGITEFAVADIFDYIFKHEDRAFVVKFSAIEIYNEAIRDLLSPDSTPLRLRDDPEKGAAV
EKATEETLRDWNHLKELISVCEAQRKIGETSLNERSSRSHQIIKLTVESSAREFLGKENS
TTLMASVNFIDLAGSERASQALSAGARLKEGCHINRSLLTLGTVIRKLSNGRQGHINYRD
SKLTRILQPCLGGNARTAIVCTLSPARSHVEQTRNTLLFACCAKEVTTKAQINVVMSDKA
LVKQLQRELARLESELRNPAPATSSCDCGVTLRKKDLQIQKMEKQLAEMTKQRDIAQSRL
EDFMKMVEHDASSKAGTPHFRNRTNKWEDGSVSEISGVVDPDRTSFISDGTSTPLSTARA
HVRSHSDDDLEEEMSPRHSGDQSEEYCKEVQCIEMEESTRDINNDSEERTDAETLLGHNA
EANGETGSAQHRIPSSVRSVRRRKSWSRGDTMTGTSTPPDALETDYRGRPEGHGFAFPDL
EFGSGGKLLRNDSMTSRGSDSTEAHSIGTPLVGEEGGITSIRSFVEGLKEMVSDPENSGK
MRKDIGVDAMEEEVSGTMTNWSEEFERQREQILGLWQTCHVSLVHRTYFFLLFTGDQADS
IYIGVELRRLSFMKESFSQGNHAFERGQTLTIASSLKALHRERRMLSKLVGKRFTGEERK
RLYQKFGIAVNSKRRRLQLANQLWSKPNDITHAVESAAVVAKLVRFVEQGRAMKEMFGLS
FTPPLPTTRRSLNWRKSMATLF

MEKTQMPVAREEKILVLVRLRPLNQKEIAANEAADWECINDTTILYRNTLREGSNFPSAY
SFDKVYRGECPTRQVYEDGTKEIALSVVKGINCSIFAYGQTSSGKTYTMTGITEFAVADI
FDYIFQHEERAFSVKFSAIEIYNEAIRDLLSSDGTSLRLRDDPEKGTVVEKATEETLRDW
NHLKELLSICEAQRKIGETSLNERSSRSHQMIRLTVESSAREFLGKENSTTLMASVNFID
LAGSERASQAMSAGTRLKEGCHINRSLLTLGTVIRKLSKGRQGHINFRDSKLTRILQPCL
GGNARTAIICTLSPARSHVELTKNTLLFACCAKEVTTKARINVVMSDKALLKQLQRELAR
LETELRNPASSPASNCDCAMTVRKKDLQIQKMEKEIAELRKQRDLAQSRLEDFMRMIEHN
VASKPGTPHFGNHTDKWEDGSVSETSGVVDSDRRSFISDGMSTPLSISRAYVHSHSDDDD
LDEDLPRRSEDLSEEYCREVQCIETEESVTVYNNKKDKRAEPENVLGCGEDANGETSVSQ
NVRVRSWNRRETVSGPSTPPENIGTGFLGRPESHKIAFPDLEFGSTVSRNDSMSSCGSDS
TGTQSIRTPLGEEGGITSIRTFVEGLKEMAKRQGEVSNAEDSGKMRRDIGLDSMDREFER
QRQEILELWQTCNISLVHRTYFYLLFKGDEADSIYIGVELRRLLFMKDSFSQGNQALEGG
ETLTLASSRKELHRERKMLSKLVGKRFSGEERKRIYHKFGIAINSKRRRLQLVNELWSNP
KDMTQVMESADVVAKLVRFAEQGRAMKEMFGLTFTPPSFLTTRRSHSWRKSMPALF

Other information
Ka divergence:0.316433KaKs divergence:-0.0751143
GC content 1 (%):47GC content 2 (%):45GC content divergence:-0.022
Length 1 (bp):2589Length 2 (bp):2511Length divergence:-0.015
MFE 1 (kcal):-826.56MFE 2 (kcal):-785.92MFE divergence-0.025