Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G21320-AT4G38960
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):B-box zinc finger family protein
Function (paralog2):B-box type zinc finger family protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:1.5821092985871
Log2 mRNA fold difference:1.6981124101405
Log2 TE fold difference:-0.54755358715035
Sequences
Protein sequence

MRILCDACESAAAIVFCAADEAALCCSCDEKVHKCNKLASRHLRVGLADPSNAPSCDICE
NAPAFFYCEIDGSSLCLQCDMVVHVGGKRTHRRFLLLRQRIEFPGDKPNHADQLGLRCQK
ASSGRGQESNGNGDHDHNMIDLNSNPQRVHEPGSHNQEEGIDVNNANNHEHE

MRILCDACENAAAIIFCAADEAALCRPCDEKALHMRLDISKCSESVKRVQIVETSSLIWW
IKMGTFCLQSLHLVVHMCNKLASRHVRVGLAEPSNAPCCDICENAPAFFYCEIDGSSLCL
QCDMVVHVGGKRTHGRFLLLRQRIEFPGDKPKENNTRDNLQNQRVSTNGNGEANGKIDDE
MIDLNANPQRVHEPSSNNNGIDVNNENNHEPAGLVPVGPFKRESEK

Other information
Ka divergence:-0.611053KaKs divergence:-0.691858
GC content 1 (%):46GC content 2 (%):43GC content divergence:-0.034
Length 1 (bp):519Length 2 (bp):681Length divergence:0.135
MFE 1 (kcal):-154MFE 2 (kcal):-185.83MFE divergence0.094