Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G21330-AT4G38970
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):fructose-bisphosphate aldolase 1
Function (paralog2):fructose-bisphosphate aldolase 2

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:1.5883500139803
Log2 mRNA fold difference:1.6340089228714
Log2 TE fold difference:-0.0072484613799967
Sequences
Protein sequence

MASSTATMLKASPVKSDWVKGQSLLLRQPSSVSAIRSHVAPSALTVRAASAYADELVKTA
KTIASPGHGIMAMDESNATCGKRLASIGLENTEANRQAYRTLLVSAPGLGQYISGAILFE
ETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLVGSYDESWCQGLDGLASRTAAYYQQ
GARFAKWRTVVSIPNGPSALAVKEAAWGLARYAAISQDSGLVPIVEPEIMLDGEHGIDRT
YDVAEKVWAEVFFYLAQNNVMFEGILLKPSMVTPGAEATDRATPEQVASYTLKLLRNRIP
PAVPGIMFLSGGQSELEATLNLNAMNQAPNPWHVSFSYARALQNTCLKTWGGKEENVKAA
QDILLARAKANSLAQLGKYTGEGESEEAKEGMFVKGYTY

MASTSLLKASPVLDKSEWVKGQSVLFRQPSSASVVLRNRATSLTVRAASSYADELVKTAK
TIASPGRGILAMDESNATCGKRLDSIGLENTEANRQAFRTLLVSAPGLGQYVSGAILFEE
TLYQSTTEGKKMVDVLVEQNIVPGIKVDKGLVPLVGSNNESWCQGLDGLSSRTAAYYQQG
ARFAKWRTVVSIPNGPSALAVKEAAWGLARYAAISQDSGLVPIVEPEILLDGEHDIDRTY
DVAEKVWAEVFFYLAQNNVMFEGILLKPSMVTPGAESKDRATPEQVAAYTLKLLRNRVPP
AVPGIMFLSGGQSEVEATLNLNAMNQAPNPWHVSFSYARALQNTCLKTWGGRPENVNAAQ
TTLLARAKANSLAQLGKYTGEGESEEAKEGMFVKGYTY

Other information
Ka divergence:-0.244496KaKs divergence:-0.322289
GC content 1 (%):53GC content 2 (%):53GC content divergence:0
Length 1 (bp):1200Length 2 (bp):1197Length divergence:-0.001
MFE 1 (kcal):-451.4MFE 2 (kcal):-420.51MFE divergence-0.035