Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G21340-AT4G39030
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):MATE efflux family protein
Function (paralog2):MATE efflux family protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-1.2234196291042
Log2 mRNA fold difference:-1.654219008122
Log2 TE fold difference:0.38207926384216
Sequences
Protein sequence

MQIQCKTLTFTVSSIPCNPKLPFPSSLTLRSWNPSFPSFRSSAVSGPKSSLKLNRFLRNC
ASTNQELVVDGETGNGSISELQGDAANGSISPVEVEAEVEEVKVDDLATQSIWGQMKEIV
MFTGPAAGLWLCGPLMSLIDTAVIGQGSSLELAALGPATVICDYLCYTFMFLSVATSNLV
ATSLARQDKDEVQHQISILLFIGLACGVTMMVLTRLFGSWALTAFTGVKNADIVPAANKY
VQIRGLAWPAVLIGWVAQSASLGMKDSWGPLKALAVASAINGVGDVVLCTFLGYGIAGAA
WATMVSQVVAAYMMMDALNKKGYSAFSFCVPSPSELLTIFGLAAPVFITMMSKVLFYTLL
VYFATSMGTNIIAAHQVMLQIYTMSTVWGEPLSQTAQSFMPELLFGINRNLPKARVLLKS
LVIIGATLGIVVGTIGTAVPWLFPGIFTRDKVVTSEMHKVIIPYFLALSITPSTHSLEGT
LLAGRDLRYISLSMTGCLAVAGLLLMLLSNGGFGLRGCWYALVGFQWARFSLSLFRLLSR
DGVLYSEDTSRYAEKVKAA

MLIKSQRLTLFSPLLSKTRRIPVNSHQTLVAESVITRRTLGAITATPSFHKNPVVIRRRI
KLERVTRNCVRIDREIDEEEEEEEKERGDLVKQSIWEQMKEIVKFTGPAMGMWICGPLMS
LIDTVVIGQGSSIELAALGPGTVLCDHMSYVFMFLSVATSNMVATSLAKQDKKEAQHQIS
VLLFIGLVCGLMMLLLTRLFGPWAVTAFTRGKNIEIVPAANKYIQIRGLAWPFILVGLVA
QSASLGMKNSWGPLKALAAATIINGLGDTILCLFLGQGIAGAAWATTASQIVSAYMMMDS
LNKEGYNAYSFAIPSPQELWKISALAAPVFISIFSKIAFYSFIIYCATSMGTHVLAAHQV
MAQTYRMCNVWGEPLSQTAQSFMPEMLYGANRNLPKARTLLKSLMIIGATLGLVLGVIGT
AVPGLFPGVYTHDKVIISEMHRLLIPFFMALSALPMTVSLEGTLLAGRDLKFVSSVMSSS
FIIGCLTLMFVTRSGYGLLGCWFVLVGFQWGRFGLYLRRLLSPGGILNSDGPSPYTVEKI
KSI

www.000webhost.com

Other information
Ka divergence:0.181939KaKs divergence:0.1076
GC content 1 (%):45GC content 2 (%):46GC content divergence:0.011
Length 1 (bp):1680Length 2 (bp):1632Length divergence:-0.014
MFE 1 (kcal):-527.04MFE 2 (kcal):-521.94MFE divergence-0.005