Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G21350-AT4G39040
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):RNA-binding CRS1 / YhbY (CRM) domain protein
Function (paralog2):RNA-binding CRS1 / YhbY (CRM) domain protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:5.2025879098846
Log2 mRNA fold difference:4.9129131857797
Log2 TE fold difference:0.22892934415881
Sequences
Protein sequence

MATAKSSTLTNLIHHLLRHRKPTSPVCLFLRPFSVSLLGRKSSHHAWISSSLPLPRPYIS
FSPLLVPKSFSSVDESEQDEDNVSLVASLNEINDDGQEDGSELTMVSMRENRRSSALELS
AKEKRKLASYAHHLGDKLKSQLVGKSGVTDSVVLSFVETLEKNELLKVKIHRTCPGELED
MILRLEEATGSVSVGQIARTVILYRPSPTKLKADEDKKRNEE

MERVTASASCSSTHLIHNLLRHPKPPSPVCLFLRPFCFSASVSQSNHRNKPRFQSFSSKP
LPCHSASLVVKSFSSIDEPDLEEDEESEDEDFSAEEYEYEDEEEEDEQDSGVVVSERGIE
DSEASEEVSEIGDKEEKTENTKKKKSRGSALKLSIKEKKELASYAHSLGDKLKCQLVGKS
GVTDSVVFSFLETLEKNELLKVKIRKTSPDELEDAVQHLEEATGSVAVGQIGRTVILYRP
SPTKMKAEAKKKEVERMSITRRQKYANTRPTKPFRREYSERPDGRGRRGGSRVPTA

Other information
Ka divergence:-0.386968KaKs divergence:0.390111
GC content 1 (%):46GC content 2 (%):46GC content divergence:0
Length 1 (bp):669Length 2 (bp):891Length divergence:0.142
MFE 1 (kcal):-176.4MFE 2 (kcal):-271.57MFE divergence0.212