Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G21380-AT4G39050
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Kinesin motor family protein
Function (paralog2):Kinesin motor family protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:0.64175816045948
Log2 mRNA fold difference:0.86331396796124
Log2 TE fold difference:-0.23066170950814
Sequences
Protein sequence

MASSSSRTRSRSPFSHRRPPSPYSSASSTSSSLINNRLLPRSSSTPTSTVYNSGGVTGSR
SMSITRTISDSGPIGGSGTYGAQSYPSEGLIGESGQTITSERDSISVTVRFRPMSEREYQ
RGDEIVWYPDADKMVRNEYNPLTAYAFDKVFGPQSTTPEVYDVAAKPVVKAAMEGVNGTV
FAYGVTSSGKTHTMHGDQDFPGIIPLAIKDVFSIIQETTGREFLLRVSYLEIYNEVINDL
LDPTGQNLRIREDSQGTYVEGIKEEVVLSPGHALSFIAAGEEHRHVGSNNFNLMSSRSHT
IFTLMIESSAHGDQYDGVIFSQLNLIDLAGSESSKTETTGLRRKEGAYINKSLLTLGTVI
GKLTEGKTTHVPFRDSKLTRLLQSSLSGHGHVSLICTVTPASSSTEETHNTLKFASRAKR
IEINASRNKIIDEKSLIKKYQKEISTLKVELDQLRRGVLVGVSHEELLSLKQQLQEGQVK
MQSRLEEEEEAKAALMSRIQKLTKLILVSTKNSIPGYLGDTPAHSRSISAGKDDKLDSLL
LDSDNLASPSSTLSLASDARRSSSKFKDENSPVGSRAELTQGVMTPDEMDLLVEQVKMLA
GEIAFGTSTLKRLVDQSMNDPENSKTQIQNLENDIQEKQRQMKSLEQRITESGEASIANA
SSIEMQEKVMRLMTQCNEKSFELEIISADNRILQEQLQTKCTENNELHEKVHLLEQRLSS
QKATLSCCDVVTEEYVDELKKKVQSQEIENEKLKLEHVQSVEEKSGLRVQNQKLAEEASY
AKELASAAAIELKNLADEVTKLSLQNAKLEKELVAARDLAAAAQKRNNNSMNSAANRNGT
RPGRKARISDSWNLNQENLTMELQARKQREAVLEAALAEKEYIEEEFRKKAEEAKRREEA
LENDLANMWVLVAKLKKANSGALSIQKSDEAEPAKEDEVTELDNKNEQNAILKERQLVNG
HEEVIVAKAEETPKEEPLVARLKARMQEMKEKEMKSQAAAAANADANSHICKVCFESPTA
TILLPCRHFCLCKSCSLACSECPICRTKISDRLFAFPS

MASSSSRTRSSRPPSPASSTSSSHLSNRLIPRSNSTSASSLITSAAGIASRSMTPSRTFS
DSGLIGSGSFGIGSPVPYPSEELLGDPMDDTISSERDSISVTVRFRPLSDREYQRGDEVA
WYPDGDTLVRHEYNPLTAYAFDKVFGPQATTIDVYDVAARPVVKAAMEGVNGTVFAYGVT
SSGKTHTMHGDQESPGIIPLAIKDVFSIIQDTPGREFLLRVSYLEIYNEVINDLLDPTGQ
NLRVREDSQGTYVEGIKEEVVLSPGHALSFIAAGEEHRHVGSNNFNLLSSRSHTIFTLMV
ESSATGDEYDGVIFSQLNLIDLAGSESSKTETTGLRRKEGSYINKSLLTLGTVIGKLSEG
KATHIPYRDSKLTRLLQSSLSGHGHVSLICTITPASSSSEETHNTLKFASRAKSIEIYAS
RNQIIDEKSLIKKYQREISTLKLELDQLRRGMLVGVSHEELMSLKQQLEEGQVKMQSRLE
EEEEAKAALMSRIQKLTKLILVSTKNSIPGYSGDIPTHQRSLSAGKDDKFDSLLLESDNL
GSPSSTLALLSEGSLGFNHRRSSSKLNDENSPGAEFTQGVMTPDEIDLLVEQVKMLAGEI
AFSTSTLKRLVDQSVNDPENSQTQIQNLEREIHEKQRQMRGLEQLIIESGEASIANASLV
EMQQKVMSLMTQCNEKSFELEIKSADNCILQEQLQEKCTENKELHEKVNLLEQRLNAVSS
EKSSPSCSNKAVSGEYADELKKKIQSQEIENEELKLEHVQIVEENSGLRVQNQKLAEEAS
YAKELASAAAVELKNLASEVTKLSLQNTKLEKELAAARDLAQTRNPMNGVNRKYNDGARS
GRKGRISSSRSSGDEFDAWNLDPEDLKMELQVRKQREVALESALAEKEFIEDEYRKKAEE
AKRREEALENDLANMWVLVAKLKKDNGALPEPNGTDPGRELEKSQSHAVLKERQVSSAPR
QPEVVVVAKTEETPKEEPLVARLKARMQEMKEKEMKSQANGDANSHICKVCFESPTAAIL
LPCRHFCLCKSCSLACSECPICRTKISDRLFAFPS

Other information
Ka divergence:-0.20718KaKs divergence:-0.248385
GC content 1 (%):43GC content 2 (%):43GC content divergence:0
Length 1 (bp):3177Length 2 (bp):3168Length divergence:-0.001
MFE 1 (kcal):-937.37MFE 2 (kcal):-943.58MFE divergence0.003