Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G21410-AT4G39080
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):vacuolar proton ATPase A2
Function (paralog2):vacuolar proton ATPase A3

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:2.4207332999962
Log2 mRNA fold difference:2.5480710064411
Log2 TE fold difference:-0.12828725152167
Sequences
Protein sequence

MAESHGGGGGCCPPMDLMRSEPMQLVQVIVPMESAHLTVSYLGDLGLVQFKDLNSEKSPF
QRTYAAQIKRCGEMARKIRFFKEQMSKAGVTPKETLDRENDIDLDDVEVKLEELEAELVE
INANNDKLQRSYNELVEYKLVLEKAGEFFASAHRSATAQQSEIETEQVGEDLLEAPLLQE
EKSVDPTKQVKLGFLTGLVPREKSMVFERILFRATRGNIFIRQSVIEESVVDPNSGEKAE
KNVFVVFYSGERAKSKILKICEAFGANRYPFSEDLGKQAQMMTEVSGRLSELKTTIGAGL
DQRNILLETIGDKFEQWNLKIRKEKAIYHTLNMLSLDVTKKCLVGEGWSPVFAATEIQDA
LHRAAVDSNSQVGSIFQVLRTKEMPPTFFRTNKFTTAFQEIVDAYGVAKYQEANPSVFTI
VTFPFLFAVMFGDWGHGICLLLATMYLILREKKLSSQKLGDIMEMAFGGRYVIFMMSLFS
IYTGLIYNEFFSIPYPLFASSAYDCRDVSCSEATTIGLIKTRDTYPFGVDPVWHGTRSEL
PFLNSLKMKMSILIGVAQMNLGIIMSFFNAKFFKSAVNIWFQFVPQMIFLNCLFGYLSVL
IIIKWCTGSQADLYHVMIYMFLSPMDDLGENQLFPNQKIVQLTFLFLALVSVPWMLLPKP
FILKKQHEARHQGLSYAQLDETDESLQVETNGGGHGHEEFEFSEIFVHQLIHTIEFVLGA
VSNTASYLRLWALSLAHSELSSVFYEKVLLMAWGFNNVFIWIVGILVFIFATVGVLLVME
TLSAFLHALRLHWVEYQNKFYEGDGYKFAPFTFTLVGNEDE

MAESGGGGGCCPPMDLMRSETMQLVQLIVPMESAHLTVSYLGDLGLVQFKDLNSEKSPFQ
RTYAAQIKRCGEMARKIRFFRDQMSKAGVPAKEMQGKENDIDLDDVEVKLGELEAELVEI
NANNDKLQRSYNELMEYKLVLQKAGEFFSSAHRSAADQQRETESQQAGEDLLESPLLQEE
KSIDSTKQVKLGFLTGLVPREKSMVFERILFRATRGNIFIRQTVIEEPVIDPNSGEKAEK
NVFVVFYSGERAKSKILKICEAFGANRYPFSEDLGRQAQMITEVSGRLSELKTTIDAGLG
QRNILLQTIGDKFELWNLKVRKEKAIYHTLNMLSLDVTKKCLVAEGWSPVFASREIQDAL
QRAAVDSNSQVGSIFQVLRTKESPPTYFRTNKFTSAIQEIVDAYGVAKYQEANPGVFTIV
TFPFLFAVMFGDWGHGICILLATMYLILKEKKLASQKLGDIMEMAFGGRYVILMMSLFSI
YTGLIYNEFFSIPFPLFAPSAYDCRDVSCSEATTIGLIKVRDTYPFGLDPVWHGSRSELP
FLNSLKMKMSILLGVSQMNLGIIMSYFNARFFKSSVNIWFQFIPQMIFLNSLFGYLSVLI
IIKWCTGSQADLYHVMIYMFLSPMDELGENQLFPHQKTLQLVLLFLALVSVPCMLLPKPF
ILKKQHEARHQGQAYAPLDETDESLHVETNGGGSHGHEEFEFSEIFVHQLIHTIEFVLGA
VSNTASYLRLWALSLAHSELSSVFYEKVLLLAWGYNNPLILIVGVLVFIFATVGVLLVME
TLSAFLHALRLHWVEFQNKFYEGDGYKFAPFTFIFTANEDE

www.000webhost.com

Other information
Ka divergence:-0.0505108KaKs divergence:0.0326864
GC content 1 (%):43GC content 2 (%):44GC content divergence:0.011
Length 1 (bp):2466Length 2 (bp):2466Length divergence:0
MFE 1 (kcal):-770.49MFE 2 (kcal):-770.28MFE divergence0