Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G21430-AT4G39090
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Papain family cysteine protease
Function (paralog2):Papain family cysteine protease

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:6.5992104618363
Log2 mRNA fold difference:5.029420517008
Log2 TE fold difference:1.4023433323247
Sequences
Protein sequence

MDYHLRVLFSVSLIFVFVSVSVCGDEDVLIRQVVDETEPKVLSSEDHFTLFKKKFGKVYG
SIEEHYYRFSVFKANLLRAMRHQKMDPSARHGVTQFSDLTRSEFRRKHLGVKGGFKLPKD
ANQAPILPTQNLPEEFDWRDRGAVTPVKNQGSCGSCWSFSTTGALEGAHFLATGKLVSLS
EQQLVDCDHECDPEEEGSCDSGCNGGLMNSAFEYTLKTGGLMREKDYPYTGTDGGSCKLD
RSKIVASVSNFSVVSINEDQIAANLIKNGPLAVAINAAYMQTYIGGVSCPYICSRRLNHG
VLLVGYGSAGFSQARLKEKPYWIIKNSWGESWGENGFYKICKGRNICGVDSLVSTVAATT
S

MDRLKLYFSVFVLSFFIVSVSSSDVNDGDDLVIRQVVGGAEPQVLTSEDHFSLFKRKFGK
VYASNEEHDYRFSVFKANLRRARRHQKLDPSATHGVTQFSDLTRSEFRKKHLGVRSGFKL
PKDANKAPILPTENLPEDFDWRDHGAVTPVKNQGSCGSCWSFSATGALEGANFLATGKLV
SLSEQQLVDCDHECDPEEADSCDSGCNGGLMNSAFEYTLKTGGLMKEEDYPYTGKDGKTC
KLDKSKIVASVSNFSVISIDEEQIAANLVKNGPLAVAINAGYMQTYIGGVSCPYICTRRL
NHGVLLVGYGAAGYAPARFKEKPYWIIKNSWGETWGENGFYKICKGRNICGVDSMVSTVA
ATVSTTAH

www.000webhost.com

Other information
Ka divergence:-0.224484KaKs divergence:-0.173502
GC content 1 (%):46GC content 2 (%):50GC content divergence:0.042
Length 1 (bp):1086Length 2 (bp):1107Length divergence:0.01
MFE 1 (kcal):-345.6MFE 2 (kcal):-373.16MFE divergence0.038