Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G21490-AT4G39130
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):dehydrin LEA
Function (paralog2):Dehydrin family protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-0.66652800281296
Log2 mRNA fold difference:1.1295811484707
Log2 TE fold difference:-1.1231900084134
Sequences
Protein sequence

MADLRDEKGNPIHLTDTQGNPIVDLTDEHGNPMYLTGVVSSTPQHKESTTSDIAEHPTST
VGETHPAAAPAGAGAATAATATGVSAGTGATTTGQQHHGSLEEHLRRSGSSSSSSSEDDG
QGGRRKKSIKEKIKEKFGSGKHKDEQTPATATTTGPATTDQPHEKKGILEKIKDKLPGHH
NHNHP

MADLKDERGNPIYLTDAHGEPAQLMDEFGNAMHLTGVATTVPHLKESSYTGPHPITAPVT
TTNTPHHAQPISVSHDPLQDHDLRWFGTSSTEENGEGVGRKTNITDETKSKLGVDKPSAA
TVTGSGSGSVHEKKGFFKKIKEKLSGHHNDL

Other information
Ka divergence:0.556237KaKs divergence:-0.237306
GC content 1 (%):53GC content 2 (%):51GC content divergence:-0.019
Length 1 (bp):558Length 2 (bp):456Length divergence:-0.101
MFE 1 (kcal):-175.5MFE 2 (kcal):-128.7MFE divergence-0.154