Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G21500-AT4G39140
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):RING/U-box superfamily protein
Function (paralog2):RING/U-box superfamily protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:0.96208395334438
Log2 mRNA fold difference:0.76745831459753
Log2 TE fold difference:0.21490563862285
Sequences
Protein sequence

MGNACCVATRDKMVVPNTSAVENFQRNNVRYSPNWSFRWDNRGGRVAGEETSVSLLSDRI
SRNDVSDVKSETALVSSQGSPLDNFQTQSWQKSPASDQSFSRIASIDSVSEQITQKTNDS
TDPTYYPSPAKLSLSLASQPSSFSVSPLSSQSHLPMPPASSSQLKLTPPPRLSKQVSYGQ
IFGFTSPSRSSATEERLGNESQSDGWSMQAFSEMMAYSRRESCSYDNECFGLRRDKIDNL
GSRKSNDQQNCGACSRSLSEKSLLSSQKIFATNELSVAAILACGHVYHSECLEQMTPEID
KFDPSCPICTLGEKKTFKLSEKALKADLEMKARHNKRLRNRVVDSDEFVKFNNNHEAAVG
YKGKTPKLISSSSLRSYSPKPFLARHFSFGSRSNSVKSPKEIHSPSSLRKKGFFWTKSSK
I

MGNACCVAARDKMVVPNSSAGENLQRSNIRHSPSWSFRWDNRGRVAGEETSLSWLSDGIS
RNDGSEIKFESAFVSSEGSPLDSFRTQTLQKSPASDLSFPRNSSMNTVFEQKENVSTESA
APSYLSPAQLSLSLASQPSSFPTSPLSSQSYLHPASSSTLKLTQHPRLSKQVSDGQIYGQ
NSLSRSSATEERQGTPTRYDSSQSGPSEGWSLQAFSEMMSSSRSNKALSYDNYDNDCFGL
QRDKIDHHGNRMSKHQQHTCGACSRPLSEKSLWSSQKIFMTNELSVSAILACGHVYHGEC
LEQMTPEIDKFDPSCPICTMGEKKTAKLSEKALKVEMDLKARHNKRLRNRVLDSDFDCDD
FVMFDHSHRTAAAASKSPRLVSSSSAKSYSAKPFLARHFSFGSRSNYKSPKENLPVKKKG
FFWTKSSKI

Other information
Ka divergence:-0.0893598KaKs divergence:-0.11669
GC content 1 (%):43GC content 2 (%):44GC content divergence:0.011
Length 1 (bp):1266Length 2 (bp):1290Length divergence:0.009
MFE 1 (kcal):-357.54MFE 2 (kcal):-384.32MFE divergence0.036