Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G21510-AT4G39150
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):DNAJ heat shock N-terminal domain-containing protein
Function (paralog2):DNAJ heat shock N-terminal domain-containing protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:3.8673570235032
Log2 mRNA fold difference:4.5033034261364
Log2 TE fold difference:-0.63400765842632
Sequences
Protein sequence

MVKETEYYEILGVKTDASDAEIKKAYYLKARKVHPDKNPGDPQAAKNFQVLGEAYQVLSN
PDKRAAYDKYGKEGVQQDAMVDPAAVFGMLFGSEVFEEYVGQLALAYLASIEADLESHDP
EIRKQMLQDKIKALQKEREDKLAATLKNKLEPFVERQTDEFIEWANEEAKRLSSAGFGEA
MMHTIGYIYTRKAAKEIGKDKRYMKVPFLAEWVRDKGHHMKSQVMAASGAVSLLQLQDEV
NKLNEHQGENKEEHIQKAIEAKMDALLQSLWQINVLDIESTLSRVCQSVLKDPSVSKDVL
RARAIGLKKLGTIFQGAKKPYTRGSSLRREATTVKMDTGGSSKATS

MVKESEYYDILGVKIDASGAEIKKAYYVQARQVHPDKNPGDPQAAKNFQILGEAYQVLGD
PEKRTAYDKYGKEGVQQDAMVDPAAVFGMLFGSELFEDYVGQLALASAASIDAELESYEP
EIRKQMLQEKIKAIQKDRVDKLVTTLKIKLEPFVEGQTDEFVNWATAEAKRLSTAGFGEA
MLHTVGYIYTRKAAKELGKDKRFMKVPFLAEWVRDKGHQVKSQVMAASGAVNLLLLQDEV
SKLNQGENKEENIQKAIEAKKDAMLQSLWQINVVDIESTLSRVCQAVLKDPSVSKDVLRA
RARGLRKLGNVFQGSKKAYSRENSLRHEEETGVKVHTGDSSKPAT

www.000webhost.com

Other information
Ka divergence:-0.0579441KaKs divergence:0.3983
GC content 1 (%):43GC content 2 (%):43GC content divergence:0
Length 1 (bp):1041Length 2 (bp):1038Length divergence:-0.001
MFE 1 (kcal):-302.51MFE 2 (kcal):-304.27MFE divergence0.003