Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G21520-AT2G21540
Species:Arabidopsis
Duplication type:TD
Function (paralog1):Sec14p-like phosphatidylinositol transfer family protein
Function (paralog2):SEC14-like 3

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-1.5994218634435
Log2 mRNA fold difference:-1.4205175910247
Log2 TE fold difference:-0.3227691772932
Sequences
Protein sequence

MSGPLDRFARPSFTTGFEGFLSSDEKKERKSDFENSEDERRTRIGSLKKKAINASTKFKH
SLKKKSGRRKSDGRVSSVSIEDVRDVEELQAVDAFRQSLLMDELLPDRHDDYHMMLRFLK
ARKFDVEKAKQMWADMIQWRKEFGTDTIIQDFDFEEINEVLKHYPQCYHGVDKEGRPIYI
ERLGKVDPNRLMQVTSMDRYVRYHVKEFERSFMIKFPSCTISAKRHIDSSTTILDVQGVG
LKNFNKSARDLITRLQKIDGDNYPETLHQMFIINAGPGFRLLWNTVKSFLDPKTSAKIHV
LGYKYLSKLLEVIDVNELPEFLGGACTCADQGGCMLSDKGPWKNPEIVKMVLHGGAHRAR
QVVKVLNSEGKVIAYAKPSYTWIKGSDTSTAESGSDAEDIGSPKAIKSFSHLRLTPVREE
AKIAGETSLAGSFPGYDEYVPMVDKAVDATWKVKPAIQRVASRGALMSPTVPKDHEGIKA
RVLVMFMAFLMAVFTFFRTVTKKLPATTTSSPAETQGNAIELGSNGEGVKEECRPPSPVP
DLTETDLLNCVTKKLTELEGKIGTLQSKPNEMPYEKEELLNAAVCRVDALEAELIATKKA
LYEALMRQEELLAYIDRQEEAQFQKMKKKKKKHLFCF

MTDTMSAHMDRHNKLDYDGSEDEKKTKLCSLKKKAINASNKFKHSFTKRTRRNSRVMSVS
IVDDIDLEELQAVDAFRQALILDELLPSKHDDHHMMLRFLRARKFDLEKAKQMWTDMIHW
RKEFGVDTIMEDFDFKEIDEVLKYYPQGYHGVDKDGRPVYIERLGQVDATKLMQVTTIDR
YVKYHVREFEKTFNIKLPACSIAAKKHIDQSTTILDVQGVGLKSFSKAARDLLQRIQKID
SDNYPETLNRMFIINAGSGFRLLWSTVKSFLDPKTTAKIHVLGNKYQSKLLEIIDSNELP
EFLGGNCTCADKGGCMRSDKGPWNDPDIFKMVQNGEGKCPRKTLSNIEEKTISVDENTTM
KSDSFAKNKFDAENTKFIPMIDKTVNASTWPTNLHKSNYPEPEDLYSAVKPSQRRGGEGY
LFGGVMSLVMGLMTVVRLTKNMPRKLTEAAIYGGEVDKAETTMVSNQEYMSMVKRMAELE
EKCRSLDNQPAAFSPEKEQILTAALSRVDELELQLAQTKKTLEETMATQHVIMAYIDKKK
KKKKFFGF

www.000webhost.com

Other information
Ka divergence:0.417294KaKs divergence:-0.0243278
GC content 1 (%):42GC content 2 (%):44GC content divergence:0.023
Length 1 (bp):1914Length 2 (bp):1647Length divergence:-0.075
MFE 1 (kcal):-560.45MFE 2 (kcal):-503.8MFE divergence-0.053