Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G21540-AT4G39180
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):SEC14-like 3
Function (paralog2):Sec14p-like phosphatidylinositol transfer family protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-2.5943882031467
Log2 mRNA fold difference:-3.4204912681221
Log2 TE fold difference:0.79349414318531
Sequences
Protein sequence

MTDTMSAHMDRHNKLDYDGSEDEKKTKLCSLKKKAINASNKFKHSFTKRTRRNSRVMSVS
IVDDIDLEELQAVDAFRQALILDELLPSKHDDHHMMLRFLRARKFDLEKAKQMWTDMIHW
RKEFGVDTIMEDFDFKEIDEVLKYYPQGYHGVDKDGRPVYIERLGQVDATKLMQVTTIDR
YVKYHVREFEKTFNIKLPACSIAAKKHIDQSTTILDVQGVGLKSFSKAARDLLQRIQKID
SDNYPETLNRMFIINAGSGFRLLWSTVKSFLDPKTTAKIHVLGNKYQSKLLEIIDSNELP
EFLGGNCTCADKGGCMRSDKGPWNDPDIFKMVQNGEGKCPRKTLSNIEEKTISVDENTTM
KSDSFAKNKFDAENTKFIPMIDKTVNASTWPTNLHKSNYPEPEDLYSAVKPSQRRGGEGY
LFGGVMSLVMGLMTVVRLTKNMPRKLTEAAIYGGEVDKAETTMVSNQEYMSMVKRMAELE
EKCRSLDNQPAAFSPEKEQILTAALSRVDELELQLAQTKKTLEETMATQHVIMAYIDKKK
KKKKFFGF

MADTMVAHMDRHNKIDVEISEDDKRLTKLCSLKKKAINATNKFKHSMTKKGRRHSRVACV
SIVDEIDTEELQAVDAFRQALILDELLPSKHDDHHMMLRFLRARKFDLEKAKQMWSDMLN
WRKEYGADTIMEDFDFKEIEEVVKYYPQGYHGVDKEGRPIYIERLGQVDATKLMKVTTID
RYVKYHVKEFEKTFNVKFPACSIAAKRHIDQSTTILDVQGVGLSNFNKAAKDLLQSIQKI
DNDNYPETLNRMFIINAGCGFRLLWNTVKSFLDPKTTAKIHVLGNKYQTKLLEIIDANEL
PEFLGGKCTCADKGGCMRSDKGPWNDPEIFKLVQNGEGRCLRRSLSGIEEKTIFEYNNET
KKKCEPEETHKQSAAEMEKKFIDTNVDAAAAADWPTKLNKAEKNPTDLKDVYSAVNPLER
KGYLYGSVMALLMGIVGVMRLTKNMPRRLTEANVYSREGSAVYQDGVTVMSKQEYIAMVK
KITDLEEKCKSMEAQAAFYMEREKTLDAALRRIDQLELQLSETNKALDETMTRQHEIMAF
IEKKKKKKRKFLLF

www.000webhost.com

Other information
Ka divergence:0.301982KaKs divergence:-0.105039
GC content 1 (%):44GC content 2 (%):44GC content divergence:0
Length 1 (bp):1647Length 2 (bp):1665Length divergence:0.005
MFE 1 (kcal):-503.8MFE 2 (kcal):-490.71MFE divergence-0.013