Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G21590-AT4G39210
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Glucose-1-phosphate adenylyltransferase family protein
Function (paralog2):Glucose-1-phosphate adenylyltransferase family protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-0.13275719966785
Log2 mRNA fold difference:0.16451572473353
Log2 TE fold difference:-0.23277178402833
Sequences
Protein sequence

MDSSYSFALGTSSSILPKLSFRNVENRFYGEKNNNNGLCKRFGSDLGSKKFRNQKFKHGV
VYAVATSDNPKKAMTVKTSMFERRKVDPQNVAAIILGGGNGAKLFPLTMRAATPAVPVGG
CYRLIDIPMSNCINSCINKIFVLTQFNSASLNRHLARTYFGNGINFGGGFVEVLAATQTP
GEAGKKWFQGTADAVRKFLWVFEDAKNRNIENILILSGDHLYRMNYMDFVQSHVDSNADI
TLSCAPVSESRASNFGLVKIDRGGRVIHFSEKPTGVDLKSMQTDTTMLGLSHQEATDSPY
IASMGVYCFKTEALLNLLTRQYPSSNDFGSEVIPAAIRDHDVQGYIFRDYWEDIGTIKTF
YEANLALVEERPKFEFYDPETPFYTSPRFLPPTKAEKCRMVDSIISHGCFLRECSVQRSI
IGERSRLDYGVELQDTLMLGADYYQTESEIASLLAEGKVPIGIGKDTKIRKCIIDKNAKI
GKNVIIMNKGDVQEADRPEEGFYIRSGITVIVEKATIQDGTVI

MDSCCNFSLGTKTVLAKDSFKNVENKFLGEKIKGSVLKPFSSDLSSKKFRNRKLRPGVAY
AIATSKNAKEALKNQPSMFERRRADPKNVAAIILGGGDGAKLFPLTKRAATPAVPVGGCY
RMIDIPMSNCINSCINKIFVLTQFNSASLNRHLARTYFGNGINFGDGFVEVLAATQTPGE
AGKKWFQGTADAVRKFLWVFEDAKNRNIENIIILSGDHLYRMNYMDFVQHHVDSKADITL
SCAPVDESRASEYGLVNIDRSGRVVHFSEKPTGIDLKSMQTDTTMHGLSHQEAAKSPYIA
SMGVYCFKTEALLKLLTWRYPSSNDFGSEIIPAAIKDHNVQGYIYRDYWEDIGTIKSFYE
ANIALVEEHPKFEFYDQNTPFYTSPRFLPPTKTEKCRIVNSVISHGCFLGECSIQRSIIG
ERSRLDYGVELQDTLMLGADSYQTESEIASLLAEGNVPIGIGRDTKIRKCIIDKNAKIGK
NVVIMNKDDVKEADRPEEGFYIRSGITVVVEKATIKDGTVI

www.000webhost.com

Other information
Ka divergence:-0.14064KaKs divergence:-0.220401
GC content 1 (%):41GC content 2 (%):42GC content divergence:0.012
Length 1 (bp):1572Length 2 (bp):1566Length divergence:-0.002
MFE 1 (kcal):-452.29MFE 2 (kcal):-465.32MFE divergence0.014