Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G21600-AT4G39220
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):endoplasmatic reticulum retrieval protein 1B
Function (paralog2):Rer1 family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.51170695693042
Log2 mRNA fold difference:-0.97272647849738
Log2 TE fold difference:0.3519142144824
Sequences
Protein sequence

MEGSGGDSGSMATPVQKKVHEAWRVYQYYLDKTTPHSTNRWIGTLVFFLIYCLRVYSIHG
FYIISYGLGIYLLNLLIGFLSPLVDPELEVSDGATLPTRGSDEFKPFIRRLPEFKFWYSM
TKAFCIAFLMTFFSVFDVPVFWPILLCYWVVLFVLTMRRQIAHMIKHKYIPFSIGKQKYS
GRKSSANSGGGSRAD

MDESGGDSGSVATPVQQRAHEAWRIYQHYLDKTTPHANYRWIGTLVVALIYCLRVYYIQG
FYIIAYGLGIYLLNLLIGFLSPLVDPEAGGVSDGPSLPTRGSDEFKPFIRRLPEFKFWYS
MTKAFCIAFLMTFFSVFDVPVFWPILLCYWIVLFVLTMRRQIAHMIKYKYIPFSFGKQKY
GGRSSSGSRAD

Other information
Ka divergence:-0.161798KaKs divergence:-0.291616
GC content 1 (%):46GC content 2 (%):47GC content divergence:0.011
Length 1 (bp):588Length 2 (bp):576Length divergence:-0.01
MFE 1 (kcal):-165.07MFE 2 (kcal):-163.8MFE divergence-0.004