Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G21650-AT4G39250
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Homeodomain-like superfamily protein
Function (paralog2):RAD-like 1

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-1.2504179068737
Log2 mRNA fold difference:-0.52570834399615
Log2 TE fold difference:-0.39000717255498
Sequences
Protein sequence

MASGSMSSYGSGSWTVKQNKAFERALAVYDQDTPDRWHNVARAVGGKTPEEAKRQYDLLV
RDIESIENGHVPFPDYKTTTGNSNRGRLRDEEKRMRSMKLQ

MASSSMSSQSSGSWTAKQNKAFEQALATYDQDTPNRWQNVAKVVGGKTTEEVKRHYELLV
QDINSIENGHVPFPNYRTSGGCTNGRLSQEEKRMRNMRLQ

www.000webhost.com

Other information
Ka divergence:-0.075042KaKs divergence:-0.129005
GC content 1 (%):48GC content 2 (%):47GC content divergence:-0.011
Length 1 (bp):306Length 2 (bp):303Length divergence:-0.005
MFE 1 (kcal):-97.7MFE 2 (kcal):-89.9MFE divergence-0.042