Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G21660-AT4G39260
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):cold, circadian rhythm, and rna binding 2
Function (paralog2):cold, circadian rhythm, and RNA binding 1

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:0.56170003987713
Log2 mRNA fold difference:-0.032044728415319
Log2 TE fold difference:0.54083972751645
Sequences
Protein sequence

MASGDVEYRCFVGGLAWATDDRALETAFAQYGDVIDSKIINDRETGRSRGFGFVTFKDEK
AMKDAIEGMNGQDLDGRSITVNEAQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGG
GGGRREGGGGYSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGGW

MSEVEYRCFVGGLAWATNDEDLQRTFSQFGDVIDSKIINDRESGRSRGFGFVTFKDEKAM
RDAIEEMNGKELDGRVITVNEAQSRGSGGGGGGRGGSGGGYRSGGGGGYSGGGGGGYSGG
GGGGYERRSGGYGSGGGGGGRGYGGGGRREGGGYGGGDGGSYGGGGGGW

Other information
Ka divergence:0.130294KaKs divergence:-0.296465
GC content 1 (%):58GC content 2 (%):59GC content divergence:0.009
Length 1 (bp):531Length 2 (bp):510Length divergence:-0.02
MFE 1 (kcal):-190.61MFE 2 (kcal):-187.02MFE divergence-0.01