Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G21940-AT4G39540
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):shikimate kinase 1
Function (paralog2):shikimate kinase 2

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:2.170227426524
Log2 mRNA fold difference:1.7547478282411
Log2 TE fold difference:0.27660120528737
Sequences
Protein sequence

MEAAITQRIQYPSWVDCRKVECKPQRGSLRYSQQVKVDRRFRGLSLARLQPERRNDQRRA
VSPAVSCSDNNSSGALLETGSVYPFDEDILKRKAEEVKPYLNGRSMYLVGMMGSGKTTVG
KLMSKVLGYTFFDCDTLIEQAMNGTSVAEIFVHHGENFFRGKETDALKKLSSRYQVVVST
GGGAVIRPINWKYMHKGISIWLDVPLEALAHRIAAVGTDSRPLLHDESGDAYSVAFKRLS
AIWDERGEAYTNANARVSLENIAAKRGYKNVSDLTPTEIAIEAFEQVLSFLEKEETMEIP
DGDL

MEAATVQRFQYSSWNDLRNFEGKPRGSLRYNTQRIKEDKRFRVVALTLDKRRDHRLRSVS
DKNSSALLETGSLLHSPFDEEQQILKKKAEEVKPYLNGRSMYLLNSFLVNALGMMGSGKT
TVGKIMARSLGYTFFDCDTLIEQAMKGTSVAEIFEHFGESVFREKETEALKKLSLMYHQV
VVSTGGGAVIRPINWKYMHKGISIWLDVPLEALAHRIAAVGTGSRPLLHDDESGDTYTAA
LNRLSTIWDARGEAYTKASARVSLENITLKLGYRSVSDLTPAEIAIEAFEQVQSYLEKED
GMARPDGL

Other information
Ka divergence:0.12792KaKs divergence:-0.999867
GC content 1 (%):43GC content 2 (%):41GC content divergence:-0.024
Length 1 (bp):915Length 2 (bp):927Length divergence:0.007
MFE 1 (kcal):-263.2MFE 2 (kcal):-281.06MFE divergence0.033