Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G22170-AT4G39730
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Lipase/lipooxygenase, PLAT/LH2 family protein
Function (paralog2):Lipase/lipooxygenase, PLAT/LH2 family protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-1.0571022115961
Log2 mRNA fold difference:0.10644240153115
Log2 TE fold difference:-1.1614978143779
Sequences
Protein sequence

MMPRRDVLFLSLLLVIATVSAVALADDEADCVYTFFLRTGSTFKAGTDSIISARVYDKYG
DYIGIRNLEAWGGLMGPGYNYYERGNLDIFSGKAPCLPSPVCSLNLTSDGSGDHHGWYVN
YVEVTTAGVHAKCSYQSFDVEQWLASDTSPYELSAVRNNCPVSLRESVGRVGSEIRKTLS
WIV

MARRDVLLPFLLLLATVSAVAFAEDDPDCVYTFYLRTGSIWKAGTDSIISARIYDKDGDY
IGIKNLQAWAGLMGPDYNYFERGNLDIFSGRAPCLPSPICALNLTSDGSGDHHGWYVNYV
EITTAGVHAQCSTQDFEIEQWLATDTSPYELTAVRNNCPVKLRDSVSRVGSEIRKKLSWV
V

www.000webhost.com

Other information
Ka divergence:0.191797KaKs divergence:-0.999883
GC content 1 (%):51GC content 2 (%):50GC content divergence:-0.01
Length 1 (bp):552Length 2 (bp):546Length divergence:-0.005
MFE 1 (kcal):-175.49MFE 2 (kcal):-179.51MFE divergence0.011