Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G22190-AT4G39770
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Haloacid dehalogenase-like hydrolase (HAD) superfamily protein
Function (paralog2):Haloacid dehalogenase-like hydrolase (HAD) superfamily protein

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:2.3450719050168
Log2 mRNA fold difference:2.8219060734573
Log2 TE fold difference:-0.33854121765778
Sequences
Protein sequence

MVRFIEENITKMLETKAISNSEVLYVGGDDGDTSPTTKVLHDFQINSGGGLIRSWVDSMR
ACSPTRPKSFNSQSCWIKEHPSALNMFEEILHKSEGKQIVMFLDYDGTLSPIVDDPDRAF
MSKKMRNTVRKLAKCFPTAIVSGRCREKVSSFVKLTELYYAGSHGMDIKGPEQGSKYKKE
NQSLLCQPATEFLPVINEVYKKLVENTQSIPGAKVENNKFCASVHFRCVEENKWSDLAHQ
VRSVLKNYPKLMLTQGRKVLEIRPIIKWDKGKALEFLLESLGYDNCTDVFPIYIGDDRTD
EDAFKILRDKKQGLGILVSKYAKETNASYSLQEPDEVMVFLERLVEWKQSRCGA

MVRFIEENTKLVEKETGNKSNNDVTTTKKKALQDIIINNGVGLINSWVDSMRACSPTHLK
SLLKQSSWLTEHPSALDMFEEILHLSEGKQIVMFLDYDGTLSPIVDDPDRAFMSRKMRRT
VRKLANCFPTAIVSGRCIEKVYNFVKLTELYYAGSHGMDIKGPEQGSKYEQILQDSKSLL
CQPATEFLPMIDEVYHKLVEKTKSTPGAQVENNKFCVSVHFRRVDENNWSDLANQVRSVM
KDYPKLRLTQGRKVLEVRPIIKWDKGKALEFLLESLGYANCTDVFPLYIGDDRTDEDAFK
VLRERRQGLGILVSKFPKETSASYSLQEPDEVMEFLQRLVEWKQLRSGA

www.000webhost.com

Other information
Ka divergence:-0.161101KaKs divergence:-0.229959
GC content 1 (%):39GC content 2 (%):39GC content divergence:0
Length 1 (bp):1065Length 2 (bp):1050Length divergence:-0.007
MFE 1 (kcal):-291.49MFE 2 (kcal):-288.62MFE divergence-0.005