Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G22200-AT4G39780
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Integrase-type DNA-binding superfamily protein
Function (paralog2):Integrase-type DNA-binding superfamily protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.27150608250567
Log2 mRNA fold difference:0.35697285715521
Log2 TE fold difference:-0.66250151312872
Sequences
Protein sequence

METASLSFPVPNTSFGVNKSMPLGLNQLTPYQIHQIQNQLNHRRSTISNLSPNRIRMKNL
TPSTSKTKNLYRGVRQRHWGKWVAEIRLPKNRTRLWLGTFETAEKAALAYDQAAFQLRGD
IAKLNFPNLIHEDMNPLPSSVDTKLQAICKSLRKTEEICSVSDQTKEYSVYSVSDKTELF
LPKAELFLPKREHLETNELSNESPRSDETSLLDESQAEYSSSDKTFLDFSDTEFEEIGSF
GLRKFPSVEIDWDAISKLANS

MAAIDMFNSNTDPFQEELMKALQPYTTNTDSSSPTYSNTVFGFNQTTSLGLNQLTPYQIH
QIQNQLNQRRNIISPNLAPKPVPMKNMTAQKLYRGVRQRHWGKWVAEIRLPKNRTRLWLG
TFDTAEEAAMAYDLAAYKLRGEFARLNFPQFRHEDGYYGGGSCFNPLHSSVDAKLQEICQ
SLRKTEDIDLPCSETELFPPKTEYQESEYGFLRSDENSFSDESHVESSSPESGITTFLDF
SDSGFDEIGSFGLEKFPSVEIDWDAISKLSES

www.000webhost.com

Other information
Ka divergence:-0.428994KaKs divergence:0.999617
GC content 1 (%):45GC content 2 (%):44GC content divergence:-0.011
Length 1 (bp):786Length 2 (bp):819Length divergence:0.021
MFE 1 (kcal):-237.22MFE 2 (kcal):-235.96MFE divergence-0.003