Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G22240-AT4G39800
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):myo-inositol-1-phosphate synthase 2
Function (paralog2):myo-inositol-1-phosphate synthase 1

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:2.3925696947222
Log2 mRNA fold difference:2.7728366281006
Log2 TE fold difference:-0.44399254887417
Sequences
Protein sequence

MFIESFKVESPNVKYTENEINSVYDYETTEVVHENRNGTYQWVVKPKTVKYDFKTDTRVP
KLGVMLVGWGGNNGSTLTAGVIANKEGISWATKDKVQQANYFGSLTQASSIRVGSYNGEE
IYAPFKSLLPMVNPEDVVFGGWDISDMNLADAMARARVLDIDLQKQLRPYMENMIPLPGI
YDPDFIAANQGSRANSVIKGTKKEQVDHIIKDMREFKEKNKVDKLVVLWTANTERYSNVI
VGLNDTTENLLASVEKDESEISPSTLYAIACVLEGIPFINGSPQNTFVPGLIELAISKNC
LIGGDDFKSGQTKMKSVLVDFLVGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKS
NVVDDMVASNGILFEPGEHPDHVVVIKYVPYVADSKRAMDEYTSEIFMGGRNTIVLHNTC
EDSLLAAPIILDLVLLAELSTRIQFKAEGEGKFHSFHPVATILSYLTKAPLVPPGTPVVN
ALSKQRAMLENILRACVGLAPENNMIMEYK

MFIESFKVESPNVKYTENEIHSVYDYETTEVVHEKTVNGTYQWIVKPKTVKYDFKTDIRV
PKLGVMLVGLGGNNGSTLTAGVIANKEGISWATKDKVQQANYFGSLTQASSIRVGSFNGE
EIYAPFKSLLPMVNPDDVVFGGWDISDMNLADAMARARVLDIDLQKQLRPYMENIVPLPG
IFDPDFIAANQGSRANHVIKGTKKEQVDHIIKDMREFKEKNKVDKVVVLWTANTERYSNV
VVGMNDTMENLMESVDRDEAEISPSTLYAIACVLEGIPFINGSPQNTFVPGLIDMAIRNN
VLIGGDDFKSGQTKMKSVLVDFLVGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISK
SNVVDDMVASNGILFEPGEHPDHVVVIKYVPYVADSKRAMDEYTSEIFMGGKNTIVMHNT
CEDSLLAAPIILDLVLLAELSTRIQFKSEGEGKFHSFHPVATILSYLTKAPLVPPGTPVI
NALSKQRAMLENIMRACVGLAPENNMIMEFK

www.000webhost.com

Other information
Ka divergence:0.238781KaKs divergence:0.438889
GC content 1 (%):44GC content 2 (%):46GC content divergence:0.022
Length 1 (bp):1533Length 2 (bp):1536Length divergence:0.001
MFE 1 (kcal):-480.62MFE 2 (kcal):-496.53MFE divergence0.016