Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G22270-AT4G39860
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:0.49759266254054
Log2 mRNA fold difference:0.84176010099612
Log2 TE fold difference:-0.32989997297321
Sequences
Protein sequence

MEEERNNPHHSTADLLSWSEIRRPDYSTAANRSNQPSDGMNDVLGGGGQITNAETKSLNT
NVSHRKNCSGHKLKEMTGSDIFSDDGKYDPNHQTRIHYHQDQLSQISFSGEENATTPMNG
KDDPNHQTRIHYHQDQRSQISFSGEENVTPKKPTTLNEAAKQKELSRTVETQADSKCKKK
QISNTKNKAMSGHDIFASPESQPRRLFGGATQSEVKGNKNTEESAPRSSRASVKTSNGQS
SNRLFSEEHVVKSSKKIHNQKSQFQGLTSNGIFKSDKIPPGYSEKMQSSAKKREMSGHNI
FADGKSEYRDYYGGARRPPGGESSISLV

MERNTPVRNPHTSTADLLSWSETPPPPHHSTPSAARSHQPSDGISKILGGGQITDEEAQS
LNKLKNCSGYKLKEMTGSGIFTDKGKVGSESDATTDPKTGLRYYQQTLNGMSQISFSADG
NVSPKKPTTLTEVAKQRELSGNLLTEADLKSNKQISSAKIEEISGHDIFAPPSEIQPRSL
VAAQQEARGNRDMGEPAPRNLRTSVKVSNPAGGQSNILFSEEPVVKTSKKIHNQKFQELT
GNGIFKGDESPGSADKQLSSAKLREMSGNNIFADGKSESRDYFGGVRKPPGGESSISLV

Other information
Ka divergence:-0.612605KaKs divergence:-0.402485
GC content 1 (%):45GC content 2 (%):47GC content divergence:0.022
Length 1 (bp):987Length 2 (bp):900Length divergence:-0.046
MFE 1 (kcal):-273.71MFE 2 (kcal):-257.67MFE divergence-0.03