Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G22310-AT4G39910
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):ubiquitin-specific protease 4
Function (paralog2):ubiquitin-specific protease 3

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:2.696471455279
Log2 mRNA fold difference:2.5138866239477
Log2 TE fold difference:0.13991710235869
Sequences
Protein sequence

MGAAGSKLEKALGDQFPEGERYFGFENFGNTCYCNSVLQDWVVDLRSVLHSMFALYFCAP
FREQLLEHYANNKADAEENLLTCLADLFSQISSQKKKTGVIAPKRFVQRLKKQNELFRSY
MHQDAHEFLNYLLNELVEILEKETQATKADNETSSSPEKIANVLKAPLANGVHKEPIVTW
VHKIFQGILTNETRCLRCETVTARDETFLDLSLDIEQNSSITSCLKNFSSTETLHAEDKF
FCDKCCSLQEAQKRMKIKKPPHILVIHLKRFKYMEQLGRYKKLSYRVVFPLELKLSNTVD
EYVDIEYSLFAVVVHVGSGPNHGHYVSLVKSHNHWLFFDDESVEIIEESAVQTFFGSSQE
YSSNTDHGYILLYESLGTR

MGAAGSKLEKALGDQFPEGERYFGFENFGNTCYCNSVLQALYFCVPFREQLLEYYTSNKS
VADAEENLMTCLADLFSQISSQKKKTGVIAPKRFVQRLKKQNELFRSYMHQDAHEFLNYL
LNEVVDILEKEAKATKTEHETSSSSSPEKIANGLKVPQANGVVHKEPIVTWVHNIFQGIL
TNETRCLRCETVTARDETFLDLSLDIEQNSSITSCLKNFSSTETLHAEDKFFCDKCCSLQ
EAQKRMKIKKPPHILVIHLKRFKYIEQLGRYKKLSYRVVFPLELKLSNTVEPYADVEYSL
FAVVVHVGSGPNHGHYVSLVKSHNHWLFFDDENVEMIEESAVQTFFGSSQEYSSNTDHGY
ILFYESLGPTK

www.000webhost.com

Other information
Ka divergence:-0.0718938KaKs divergence:-0.30683
GC content 1 (%):42GC content 2 (%):44GC content divergence:0.023
Length 1 (bp):1140Length 2 (bp):1116Length divergence:-0.011
MFE 1 (kcal):-320.28MFE 2 (kcal):-323.39MFE divergence0.005