Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G22330-AT4G39950
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):cytochrome P450, family 79, subfamily B, polypeptide 3
Function (paralog2):cytochrome P450, family 79, subfamily B, polypeptide 2

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:0.90195844368602
Log2 mRNA fold difference:0.25480139032112
Log2 TE fold difference:0.63875562077611
Sequences
Protein sequence

MDTLASNSSDLTTKSSLGMSSFTNMYLLTTLQALAALCFLMILNKIKSSSRNKKLHPLPP
GPTGFPIVGMIPAMLKNRPVFRWLHSLMKELNTEIACVRLGNTHVIPVTCPKIAREIFKQ
QDALFASRPLTYAQKILSNGYKTCVITPFGEQFKKMRKVIMTEIVCPARHRWLHDNRAEE
TDHLTAWLYNMVKNSEPVDLRFVTRHYCGNAIKRLMFGTRTFSEKTEADGGPTLEDIEHM
DAMFEGLGFTFAFCISDYLPMLTGLDLNGHEKIMRESSAIMDKYHDPIIDERIKMWREGK
RTQIEDFLDIFISIKDEAGQPLLTADEIKPTIKELVMAAPDNPSNAVEWAIAEMINKPEI
LHKAMEEIDRVVGKERFVQESDIPKLNYVKAIIREAFRLHPVAAFNLPHVALSDTTVAGY
HIPKGSQVLLSRYGLGRNPKVWSDPLSFKPERHLNECSEVTLTENDLRFISFSTGKRGCA
APALGTAITTMMLARLLQGFKWKLAGSETRVELMESSHDMFLSKPLVLVGELRLSEDLYP
MVK

MNTFTSNSSDLTTTATETSSFSTLYLLSTLQAFVAITLVMLLKKLMTDPNKKKPYLPPGP
TGWPIIGMIPTMLKSRPVFRWLHSIMKQLNTEIACVKLGNTHVITVTCPKIAREILKQQD
ALFASRPLTYAQKILSNGYKTCVITPFGDQFKKMRKVVMTELVCPARHRWLHQKRSEEND
HLTAWVYNMVKNSGSVDFRFMTRHYCGNAIKKLMFGTRTFSKNTAPDGGPTVEDVEHMEA
MFEALGFTFAFCISDYLPMLTGLDLNGHEKIMRESSAIMDKYHDPIIDERIKMWREGKRT
QIEDFLDIFISIKDEQGNPLLTADEIKPTIKELVMAAPDNPSNAVEWAMAEMVNKPEILR
KAMEEIDRVVGKERLVQESDIPKLNYVKAILREAFRLHPVAAFNLPHVALSDTTVAGYHI
PKGSQVLLSRYGLGRNPKVWADPLCFKPERHLNECSEVTLTENDLRFISFSTGKRGCAAP
ALGTALTTMMLARLLQGFTWKLPENETRVELMESSHDMFLAKPLVMVGDLRLPEHLYPTV
K

www.000webhost.com

Other information
Ka divergence:0.0537702KaKs divergence:-0.416533
GC content 1 (%):45GC content 2 (%):48GC content divergence:0.032
Length 1 (bp):1632Length 2 (bp):1626Length divergence:-0.002
MFE 1 (kcal):-510.34MFE 2 (kcal):-512.39MFE divergence0.002