Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G22360-AT4G39960
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):DNAJ heat shock family protein
Function (paralog2):Molecular chaperone Hsp40/DnaJ family protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:0.22563638662019
Log2 mRNA fold difference:-0.3241920976398
Log2 TE fold difference:0.57342110228088
Sequences
Protein sequence

MAIIQLGSTCVAQWSIRPQFAVRAYYPSRIESTRHQNSSSQVNCLGASKSSMFSHGSLPF
LSMTGMSRNMHPPRRGSRFTVRADADYYSVLGVSKNATKAEIKSAYRKLARNYHPDVNKD
PGAEEKFKEISNAYEVLSDDEKKSLYDRYGEAGLKGAAGFGNGDFSNPFDLFDSLFEGFG
GGMGRGSRSRAVDGQDEYYTLILNFKEAVFGMEKEIEISRLESCGTCEGSGAKPGTKPTK
CTTCGGQGQVVSAARTPLGVFQQVMTCSSCNGTGEISTPCGTCSGDGRVRKTKRISLKVP
AGVDSGSRLRVRGEGNAGKRGGSPGDLFVVIEVIPDPILKRDDTNILYTCKISYIDAILG
TTLKVPTVDGTVDLKVPAGTQPSTTLVMAKKGVPVLNKSNMRGDQLVRVQVEIPKRLSKE
EKKLIEELADMSKNKTANSTSR

MALIQFGSSCVAQWGILRPRFAVKAFYPSRLESHQDNCISQINCLGASRSSMFAQGSLPF
LSLTGVSPNTHSRRGARFTVRADTDFYSVLGVSKNATKAEIKSAYRKLARSYHPDVNKDA
GAEDKFKEISNAYEILSDDEKRSLYDRYGEAGVKGAGMGGMGDYSNPFDLFESLFEGMGG
MGGMGGGMGSRGSRSRAIDGEDEYYSLILNFKEAVFGIEKEIEISRLESCGTCNGSGAKA
GTKPTKCKTCGGQGQVVASTRTPLGVFQQVMTCSPCNGTGEISKPCGACSGDGRVRRTKR
ISLKVPAGVDSGSRLRVRGEGNAGKRGGSPGDLFAVIEVIPDPVLKRDDTNILYTCKISY
VDAILGTTLKVPTVDGEVDLKVPAGTQPSTTLVMAKKGVPVLNKSKMRGDQLVRVQVEIP
KRLSKEEKMLVEELADMSKNKVANSRR

www.000webhost.com

Other information
Ka divergence:0.123624KaKs divergence:0.166871
GC content 1 (%):45GC content 2 (%):44GC content divergence:-0.011
Length 1 (bp):1329Length 2 (bp):1344Length divergence:0.006
MFE 1 (kcal):-397.94MFE 2 (kcal):-389.08MFE divergence-0.011