Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G22400-AT4G40000
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):S-adenosyl-L-methionine-dependent methyltransferases superfamily protein
Function (paralog2):S-adenosyl-L-methionine-dependent methyltransferases superfamily protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.96322979543506
Log2 mRNA fold difference:-1.8630063021267
Log2 TE fold difference:0.78394503308168
Sequences
Protein sequence

MGRGGRHRGRTQRKDFKESRENVWKRPKSDASVDGSDNAVPEQKPTWEPIVTVNPNFEEY
YKKQGIVKAEEWDLFMEILRKPLPAAFRVNSNGQFCDEIISILENDFMKSLQAEAIEGGE
LEAIKPLPWYPKNLAWHSNFSRKEIRKNQTLERFHEFLKLENEVGNITRQEAVSMVPPLF
LDVHPDHFVLDMCAAPGSKTFQLLEIIHEASEPGSLPNGLVVANDVDFKRSNLLIHQTKR
MCTSNLIVTNHEGQQFPGCRLNKSRASEKGISENMPINQLAFDRVLCDVPCSGDGTLRKA
PDIWRKWNSGMGNGLHSLQIILAMRGLSLLKVGGKMIYSTCSMNPVEDEAVVAEILRRCG
DSVELLDVSDKLPELIRRPGLKAWKVRDKGGWFTSYKDVPQNRRGGVLVSMFPSGKYLKD
STETTEKNENGDVNGCEDGLKETDISVVDATPEEQAEEVSDLPLERCMRIIPHDQNTGAF
FIAVLQKKSPLPEFQEKPNTKRNSTAKSTDSTEKSPSKESVVTVDAGVPDESAVEKVIEA
DSNIEKNDSLEPEKKITEGESITEDKEANSSNAGGKRKVPMQGKWKGFDPVVFVKDETVI
NGIKEFYGIKDESFPLHGHLVARNTDTSSVKRIYYVSKSVKEVLQLNFAVGQQLKIASVG
LKMFERQSAKEGSSTLCPFRISSEGLPVILPYITKQVLYTPMADFKLLLQDKSIKFHDFV
NPQLAQKATDLVMGSCVVILSDGEVPVKADASTIAISCWRGKASLAVMATVADCQELLER
FAEKTPKTEGGSVNGSNGDSDGPLAMET

MGRGRRHRGSTSKRNQIENSNDDNVRKPLKSEASFDSNNLQKPICSNLHFEEYYKEQRIV
KAQEWDSFMEFLRKPLPAAFRVYSNGQFCDEIRLKLENDFMISLQAEAIESGELEAIKPL
PWYPKNLAWHSNFSRKEIRKNQTLERFHEFLKLETEAGNMTRQESVSMVPPLFLDVHPDH
FVLDMCAAPGSKTFQLLEIIHESSEPGSLPNGMVVANDVDYKRSNLLIHQTKRTCTTNLM
VTNNEGQHFPSCNTKRTLSVASETNPHPIDQLLFDRVLCDVPCSGDGTLRKAPDIWRRWN
SGSGNGLHSLQVVLAMRGLSLLKVGGRMVYSTCSMNPIEDEAVVAEILRRCGCSVELVDV
SDKLPELIRRPGLTKWKVHDRGGWYRSYKDVPKSQRDGVLRSMFPSGKSDKDSSGGKNSY
EEMASISSDESAEEVCDLPLELCMRILPHDQNTGGFFIAVLHKVSPLPDFQEKVTQKRNL
STRNNINSSEKSSSYEAVSDTVVTKPEEGTEEIVLEATVSENGFEPPEMESTWNEGIVEL
AQKLDDIEGKREVPSMQGKWKGLYPVVFLRDQTGINGIKTFYGIKDESFPLYGHLVTRNS
DISSHGNVKRIYYVSKAVKNVLELNFAVGKPLKISSVGLKMFEKQSAKECEANCCSFRIT
SEGLPVILPYMTKQILYATMADFKNLLQHKSIKFLDFIHPQIGEKAAELALGSCVMVLVD
DSQLGSEQFKVNSSTIAIGCWKGKASLTVMVTTVDCHQLIQRLSDRSKEKEKAENCFKTA
ETA

Other information
Ka divergence:0.231827KaKs divergence:0.154691
GC content 1 (%):43GC content 2 (%):41GC content divergence:-0.024
Length 1 (bp):2427Length 2 (bp):2352Length divergence:-0.016
MFE 1 (kcal):-718.17MFE 2 (kcal):-696.1MFE divergence-0.016