Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G22430-AT4G40060
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):homeobox protein 6
Function (paralog2):homeobox protein 16

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-0.3973351880241
Log2 mRNA fold difference:0.73896955724914
Log2 TE fold difference:-1.1055407630886
Sequences
Protein sequence

MMKRLSSSDSVGGLISLCPTTSTDEQSPRRYGGREFQSMLEGYEEEEEAIVEERGHVGLS
EKKRRLSINQVKALEKNFELENKLEPERKVKLAQELGLQPRQVAVWFQNRRARWKTKQLE
KDYGVLKTQYDSLRHNFDSLRRDNESLLQEISKLKTKLNGGGGEEEEEENNAAVTTESDI
SVKEEEVSLPEKITEAPSSPPQFLEHSDGLNYRSFTDLRDLLPLKAAASSFAAAAGSSDS
SDSSALLNEESSSNVTVAAPVTVPGGNFFQFVKMEQTEDHEDFLSGEEACEFFSDEQPPS
LHWYSTVDHWN

MKRLSSSDSMCGLISTSTDEQSPRGYGSNYQSMLEGYDEDATLIEEYSGNHHHMGLSEKK
RRLKVDQVKALEKNFELENKLEPERKTKLAQELGLQPRQVAVWFQNRRARWKTKQLEKDY
GVLKGQYDSLRHNFDSLRRDNDSLLQEISKIKAKVNGEEDNNNNKAITEGVKEEEVHKTD
SIPSSPLQFLEHSSGFNYRRSFTDLRDLLPNSTVVEAGSSDSCDSSAVLNDETSSDNGRL
TPPVTVTGGSFLQFVKTEQTEDHEDFLSGEEACGFFSDEQPPSLHWYSASDHWT

Other information
Ka divergence:0.246806KaKs divergence:-0.355569
GC content 1 (%):45GC content 2 (%):44GC content divergence:-0.011
Length 1 (bp):936Length 2 (bp):885Length divergence:-0.028
MFE 1 (kcal):-303.61MFE 2 (kcal):-264.2MFE divergence-0.069